BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0599.Seq (871 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016675-4|AAB66137.1| 356|Caenorhabditis elegans Hypothetical ... 29 5.7 Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical pr... 28 10.0 >AF016675-4|AAB66137.1| 356|Caenorhabditis elegans Hypothetical protein T27B7.5 protein. Length = 356 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 313 NTTHYRANWVPGPPVEVGRHFTLNKLECS 227 N R+ W PP E+GR F ++K+E S Sbjct: 317 NNLMQRSIWEARPPREIGRVFNISKIEFS 345 >Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical protein F38A6.2 protein. Length = 891 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 480 LPFAIQXAQLLGRAIGAGLFAITPAGE--RGMCCKAIKLGNARV 355 L F+ L G++IGA L T AGE G K +K G++RV Sbjct: 761 LDFSSDSQYLRGQSIGAHLLFWTKAGEICDGTSVKDVKWGSSRV 804 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,709,962 Number of Sequences: 27780 Number of extensions: 352937 Number of successful extensions: 651 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2181923744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -