SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0594.Seq
         (823 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A7M4C4 Cluster: Putative uncharacterized protein; n=1; ...    36   0.93 

>UniRef50_A7M4C4 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides ovatus ATCC 8483|Rep: Putative
           uncharacterized protein - Bacteroides ovatus ATCC 8483
          Length = 573

 Score = 36.3 bits (80), Expect = 0.93
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +2

Query: 212 NGFGNKAVFLVRRFTSFWVIEVYNSSLIE-VFKKKSLTPTSKFPG 343
           NGF  KA  LV  ++S W  + YN +  E +F +++ T T+ F G
Sbjct: 268 NGFAEKAKLLVEDYSSLWSKDNYNDATNELIFLRRATTTTNSFEG 312


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 742,261,138
Number of Sequences: 1657284
Number of extensions: 14117084
Number of successful extensions: 25679
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 25037
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25676
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 70914189703
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -