BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0593.Seq (867 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF026209-4|AAW88411.1| 317|Caenorhabditis elegans Serpentine re... 36 0.028 >AF026209-4|AAW88411.1| 317|Caenorhabditis elegans Serpentine receptor, class h protein2, isoform b protein. Length = 317 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 46 PPCFICLLLYILRFEISNIIIFMYKMRNARAHTAKTSKRRV-HVQT 180 P CF+ L++ ++ ++ I IF+Y+M A HTA T ++ H QT Sbjct: 90 PECFLILVVILIYNGLACIFIFLYRMEVASKHTAPTMLYKITHFQT 135 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,208,518 Number of Sequences: 27780 Number of extensions: 393324 Number of successful extensions: 807 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2171433726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -