BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0583.Seq (849 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 3.1 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 23 3.1 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 22 7.0 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 22 7.0 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 22 7.0 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.0 bits (47), Expect = 3.1 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -1 Query: 300 FQRVRD*FNDTVRMRDRNDTRSERVLNE*NSYGLPRDRLKSTTNGSR 160 F RV+D F + V +R + + V + + YGL + + +GSR Sbjct: 579 FDRVKDLFLEAVLLRYPDLNKIFYVQTDSSGYGLGAELYQIQEDGSR 625 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 451 AMIQFRALGGGPVPNSPYSGRITIHWPSFYNVV 549 A I F G P+P Y+ T W S +N V Sbjct: 237 AEIAFAYKYGDPIPYIQYTETETKTWGSVFNTV 269 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 65 DGTFVSCVRSPSARYV 112 DGT + C++S AR + Sbjct: 251 DGTMIKCLKSRPARQI 266 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 65 DGTFVSCVRSPSARYV 112 DGT + C++S AR + Sbjct: 251 DGTMIKCLKSRPARQI 266 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 324 YEKIFFRNFQRVRD*FNDTVRMRDRNDTRSERVL 223 Y +I + +Q +RD F D+ R NDT + L Sbjct: 15 YPEIQEKVYQELRDIFQDSDRPITFNDTLQMKYL 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,382 Number of Sequences: 336 Number of extensions: 3467 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23451794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -