BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0581.Seq (523 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1184 + 34802749-34802892,34802981-34803220,34803636-348039... 28 5.2 02_02_0009 + 6068260-6068591,6068797-6068917,6069034-6069122,606... 28 5.2 >02_05_1184 + 34802749-34802892,34802981-34803220,34803636-34803950, 34804030-34804209,34804312-34804504,34805062-34805324, 34805461-34805590,34805719-34805786,34805951-34806199, 34806284-34806357,34808052-34808143,34808603-34808685, 34810337-34810408,34810558-34810683,34810996-34811037 Length = 756 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 391 ENCRVQNVGFLEGVKIGRCILINHKSFILYNC*LE 495 ENC+V N +G IG+ +LI H S+I N +E Sbjct: 381 ENCKVSNSVIGQGCNIGKNVLI-HGSYIWDNVTIE 414 >02_02_0009 + 6068260-6068591,6068797-6068917,6069034-6069122, 6069207-6069291,6069421-6069580,6069667-6069743, 6069848-6069898,6069979-6070069,6070167-6070468, 6070549-6070830,6070911-6071388,6071457-6071560, 6071647-6071809,6071895-6072017,6072099-6072217, 6072304-6072636,6072713-6073003,6073088-6073171, 6073260-6073393,6073478-6073705,6073795-6073966, 6074062-6074316,6074408-6074668 Length = 1444 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 223 WYNSEIGNILGYLIVYNFQFIKLL 294 WY +G +LGY++++N FI L Sbjct: 751 WYWIGVGALLGYIMLFNILFILFL 774 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,515,004 Number of Sequences: 37544 Number of extensions: 169382 Number of successful extensions: 254 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -