BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0574.Seq (989 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 49 7e-06 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 49 7e-06 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 48 9e-06 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 48 9e-06 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 48 9e-06 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 48 9e-06 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 48 9e-06 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 48 9e-06 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 48 9e-06 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 48 9e-06 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 48 9e-06 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 48 9e-06 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 48 9e-06 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 48 9e-06 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 48 9e-06 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 48 9e-06 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 48 9e-06 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 48 9e-06 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 48 9e-06 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 48 9e-06 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 48 9e-06 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 48 9e-06 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 48 9e-06 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 48 9e-06 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 48 9e-06 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 48 9e-06 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 48 9e-06 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 48 9e-06 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 48 9e-06 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 48 9e-06 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 48 9e-06 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 48 9e-06 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 48 9e-06 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 48 9e-06 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 48 9e-06 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 48 9e-06 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 48 9e-06 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 48 9e-06 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 48 9e-06 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 48 9e-06 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 48 9e-06 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 48 9e-06 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 48 9e-06 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 48 9e-06 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 48 9e-06 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 48 9e-06 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 48 9e-06 SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28658| Best HMM Match : I-set (HMM E-Value=1.5) 48 9e-06 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26211| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26011| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 48 9e-06 SB_25260| Best HMM Match : PqiA (HMM E-Value=0.3) 48 9e-06 SB_25256| Best HMM Match : G-patch (HMM E-Value=3.7) 48 9e-06 SB_25128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 48 9e-06 SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_24080| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23634| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22975| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22925| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_22609| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21773| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 48 9e-06 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20345| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20175| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20124| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19473| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_19023| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 48 9e-06 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_18032| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 48 9e-06 SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 48 9e-06 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 48 9e-06 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16611| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16365| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_16003| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15793| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15304| Best HMM Match : Herpes_UL49_5 (HMM E-Value=1.3) 48 9e-06 SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14400| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14226| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14098| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 48 9e-06 SB_13829| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13824| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13406| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13252| Best HMM Match : Ligase_CoA (HMM E-Value=9.1) 48 9e-06 SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) 48 9e-06 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12650| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12301| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11368| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10030| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9824| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9660| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) 48 9e-06 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 48 9e-06 SB_7695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) 48 9e-06 SB_7569| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7353| Best HMM Match : CAT (HMM E-Value=7.9e-08) 48 9e-06 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7229| Best HMM Match : Neurokinin_B (HMM E-Value=7.9) 48 9e-06 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7001| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) 48 9e-06 SB_6528| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 48 9e-06 SB_6371| Best HMM Match : PSI_PsaJ (HMM E-Value=2.6) 48 9e-06 SB_6347| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6048| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/62 (54%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ G + KARTD PSQ L G Sbjct: 123 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEKARTDRPSQQLRSLN-G 180 Query: 900 NW 905 W Sbjct: 181 EW 182 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 51.6 bits (118), Expect = 1e-06 Identities = 34/65 (52%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ G + +ARTD PSQ L Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFTSWG-NSEEARTDRPSQQLRSL 99 Query: 891 XLGNW 905 G W Sbjct: 100 N-GEW 103 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 51.6 bits (118), Expect = 1e-06 Identities = 34/62 (54%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ G KARTD PSQ L G Sbjct: 21 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NNEKARTDRPSQQLRSLN-G 78 Query: 900 NW 905 W Sbjct: 79 EW 80 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 51.2 bits (117), Expect = 1e-06 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ G + +ARTD PSQ L G Sbjct: 59 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEEARTDRPSQQLRSLN-G 116 Query: 900 NW 905 W Sbjct: 117 EW 118 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/65 (52%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL F R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVFLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 2e-06 Identities = 34/65 (52%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF++ + KARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFARWR-NSQKARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 50.0 bits (114), Expect = 3e-06 Identities = 34/65 (52%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + KARTD PSQ L Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEKARTDRPSQQLRSL 105 Query: 891 XLGNW 905 G W Sbjct: 106 N-GEW 109 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 4e-06 Identities = 37/79 (46%), Positives = 41/79 (51%), Gaps = 2/79 (2%) Frame = +3 Query: 675 RHFLRAXKXGGAGNQFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAX 848 RH +R G A N SESY NSL R WE PGVTQLN L H PF+ + Sbjct: 8 RHLVRHIT-GHAKNDALSSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSE 65 Query: 849 KARTDWPSQXFXPLXLGNW 905 +ARTD PSQ L G W Sbjct: 66 EARTDRPSQQLRSLN-GEW 83 >SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 49.6 bits (113), Expect = 4e-06 Identities = 33/63 (52%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = +3 Query: 723 AYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXL 896 AYSESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 20 AYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLN- 77 Query: 897 GNW 905 G W Sbjct: 78 GEW 80 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 49.6 bits (113), Expect = 4e-06 Identities = 33/62 (53%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ + KARTD PSQ L G Sbjct: 115 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEKARTDRPSQQLRSLN-G 172 Query: 900 NW 905 W Sbjct: 173 EW 174 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.2 bits (112), Expect = 5e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 41 QFALYESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 99 Query: 891 XLGNW 905 G W Sbjct: 100 N-GEW 103 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 49.2 bits (112), Expect = 5e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 48.8 bits (111), Expect = 7e-06 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ KARTD PSQ L Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NNEKARTDRPSQQLRSL 96 Query: 891 XLGNW 905 G W Sbjct: 97 N-GEW 100 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 48.8 bits (111), Expect = 7e-06 Identities = 32/62 (51%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L G Sbjct: 212 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-TSEEARTDRPSQQLRSLN-G 269 Query: 900 NW 905 W Sbjct: 270 EW 271 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 48.8 bits (111), Expect = 7e-06 Identities = 33/65 (50%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF++ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFARWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.8 bits (111), Expect = 7e-06 Identities = 32/62 (51%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L G Sbjct: 57 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLRSLN-G 114 Query: 900 NW 905 W Sbjct: 115 EW 116 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 82 Query: 891 XLGNW 905 G W Sbjct: 83 N-GEW 86 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 109 Query: 891 XLGNW 905 G W Sbjct: 110 N-GEW 113 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 85 Query: 891 XLGNW 905 G W Sbjct: 86 N-GEW 89 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 117 Query: 891 XLGNW 905 G W Sbjct: 118 N-GEW 121 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 93 Query: 891 XLGNW 905 G W Sbjct: 94 N-GEW 97 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 100 Query: 891 XLGNW 905 G W Sbjct: 101 N-GEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 116 Query: 891 XLGNW 905 G W Sbjct: 117 N-GEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 104 Query: 891 XLGNW 905 G W Sbjct: 105 N-GEW 108 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 130 Query: 891 XLGNW 905 G W Sbjct: 131 N-GEW 134 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 92 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 150 Query: 891 XLGNW 905 G W Sbjct: 151 N-GEW 154 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 190 Query: 891 XLGNW 905 G W Sbjct: 191 N-GEW 194 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 49 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 107 Query: 891 XLGNW 905 G W Sbjct: 108 N-GEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 120 Query: 891 XLGNW 905 G W Sbjct: 121 N-GEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 103 Query: 891 XLGNW 905 G W Sbjct: 104 N-GEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 116 Query: 891 XLGNW 905 G W Sbjct: 117 N-GEW 120 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRLDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 97 Query: 891 XLGNW 905 G W Sbjct: 98 N-GEW 101 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 84 Query: 891 XLGNW 905 G W Sbjct: 85 N-GEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 90 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 148 Query: 891 XLGNW 905 G W Sbjct: 149 N-GEW 152 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 105 Query: 891 XLGNW 905 G W Sbjct: 106 N-GEW 109 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 92 Query: 891 XLGNW 905 G W Sbjct: 93 N-GEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 101 Query: 891 XLGNW 905 G W Sbjct: 102 N-GEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 102 Query: 891 XLGNW 905 G W Sbjct: 103 N-GEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 57 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 115 Query: 891 XLGNW 905 G W Sbjct: 116 N-GEW 119 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 100 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 158 Query: 891 XLGNW 905 G W Sbjct: 159 N-GEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 114 Query: 891 XLGNW 905 G W Sbjct: 115 N-GEW 118 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 150 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 208 Query: 891 XLGNW 905 G W Sbjct: 209 N-GEW 212 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 99 Query: 891 XLGNW 905 G W Sbjct: 100 N-GEW 103 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 89 Query: 891 XLGNW 905 G W Sbjct: 90 N-GEW 93 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 88 Query: 891 XLGNW 905 G W Sbjct: 89 N-GEW 92 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 98 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 156 Query: 891 XLGNW 905 G W Sbjct: 157 N-GEW 160 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 105 Query: 891 XLGNW 905 G W Sbjct: 106 N-GEW 109 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 142 Query: 891 XLGNW 905 G W Sbjct: 143 N-GEW 146 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 90 Query: 891 XLGNW 905 G W Sbjct: 91 N-GEW 94 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 85 Query: 891 XLGNW 905 G W Sbjct: 86 N-GEW 89 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 136 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 194 Query: 891 XLGNW 905 G W Sbjct: 195 N-GEW 198 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 102 Query: 891 XLGNW 905 G W Sbjct: 103 N-GEW 106 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 104 Query: 891 XLGNW 905 G W Sbjct: 105 N-GEW 108 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 85 Query: 891 XLGNW 905 G W Sbjct: 86 N-GEW 89 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 89 Query: 891 XLGNW 905 G W Sbjct: 90 N-GEW 93 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 103 Query: 891 XLGNW 905 G W Sbjct: 104 N-GEW 107 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 97 Query: 891 XLGNW 905 G W Sbjct: 98 N-GEW 101 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 115 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 173 Query: 891 XLGNW 905 G W Sbjct: 174 N-GEW 177 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 157 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 215 Query: 891 XLGNW 905 G W Sbjct: 216 N-GEW 219 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 130 Query: 891 XLGNW 905 G W Sbjct: 131 N-GEW 134 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 104 Query: 891 XLGNW 905 G W Sbjct: 105 N-GEW 108 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 88 Query: 891 XLGNW 905 G W Sbjct: 89 N-GEW 92 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 136 Query: 891 XLGNW 905 G W Sbjct: 137 N-GEW 140 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 452 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 510 Query: 891 XLGNW 905 G W Sbjct: 511 N-GEW 514 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 101 Query: 891 XLGNW 905 G W Sbjct: 102 N-GEW 105 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 86 Query: 891 XLGNW 905 G W Sbjct: 87 N-GEW 90 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 91 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 149 Query: 891 XLGNW 905 G W Sbjct: 150 N-GEW 153 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 114 Query: 891 XLGNW 905 G W Sbjct: 115 N-GEW 118 >SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 136 Query: 891 XLGNW 905 G W Sbjct: 137 N-GEW 140 >SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 94 Query: 891 XLGNW 905 G W Sbjct: 95 N-GEW 98 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 85 Query: 891 XLGNW 905 G W Sbjct: 86 N-GEW 89 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 117 Query: 891 XLGNW 905 G W Sbjct: 118 N-GEW 121 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 119 Query: 891 XLGNW 905 G W Sbjct: 120 N-GEW 123 >SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 94 Query: 891 XLGNW 905 G W Sbjct: 95 N-GEW 98 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 181 Query: 891 XLGNW 905 G W Sbjct: 182 N-GEW 185 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 227 Query: 891 XLGNW 905 G W Sbjct: 228 N-GEW 231 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 124 Query: 891 XLGNW 905 G W Sbjct: 125 N-GEW 128 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 100 Query: 891 XLGNW 905 G W Sbjct: 101 N-GEW 104 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 229 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 287 Query: 891 XLGNW 905 G W Sbjct: 288 N-GEW 291 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 99 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 157 Query: 891 XLGNW 905 G W Sbjct: 158 N-GEW 161 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 92 Query: 891 XLGNW 905 G W Sbjct: 93 N-GEW 96 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 92 Query: 891 XLGNW 905 G W Sbjct: 93 N-GEW 96 >SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 84 Query: 891 XLGNW 905 G W Sbjct: 85 N-GEW 88 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 76 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 134 Query: 891 XLGNW 905 G W Sbjct: 135 N-GEW 138 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 124 Query: 891 XLGNW 905 G W Sbjct: 125 N-GEW 128 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 109 Query: 891 XLGNW 905 G W Sbjct: 110 N-GEW 113 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 119 Query: 891 XLGNW 905 G W Sbjct: 120 N-GEW 123 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEQARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 116 Query: 891 XLGNW 905 G W Sbjct: 117 N-GEW 120 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 102 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 160 Query: 891 XLGNW 905 G W Sbjct: 161 N-GEW 164 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 85 Query: 891 XLGNW 905 G W Sbjct: 86 N-GEW 89 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 99 Query: 891 XLGNW 905 G W Sbjct: 100 N-GEW 103 >SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 87 Query: 891 XLGNW 905 G W Sbjct: 88 N-GEW 91 >SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 126 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 184 Query: 891 XLGNW 905 G W Sbjct: 185 N-GEW 188 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 89 Query: 891 XLGNW 905 G W Sbjct: 90 N-GEW 93 >SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) Length = 163 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 119 Query: 891 XLGNW 905 G W Sbjct: 120 N-GEW 123 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 190 Query: 891 XLGNW 905 G W Sbjct: 191 N-GEW 194 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 105 Query: 891 XLGNW 905 G W Sbjct: 106 N-GEW 109 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 151 Query: 891 XLGNW 905 G W Sbjct: 152 N-GEW 155 >SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) Length = 261 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 159 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 217 Query: 891 XLGNW 905 G W Sbjct: 218 N-GEW 221 >SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) Length = 136 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 93 Query: 891 XLGNW 905 G W Sbjct: 94 N-GEW 97 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 67 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 125 Query: 891 XLGNW 905 G W Sbjct: 126 N-GEW 129 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 112 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 170 Query: 891 XLGNW 905 G W Sbjct: 171 N-GEW 174 >SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 84 Query: 891 XLGNW 905 G W Sbjct: 85 N-GEW 88 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 249 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 307 Query: 891 XLGNW 905 G W Sbjct: 308 N-GEW 311 Score = 48.0 bits (109), Expect = 1e-05 Identities = 32/62 (51%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L G Sbjct: 361 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLN-G 418 Query: 900 NW 905 W Sbjct: 419 EW 420 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 80 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 138 Query: 891 XLGNW 905 G W Sbjct: 139 N-GEW 142 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 93 Query: 891 XLGNW 905 G W Sbjct: 94 N-GEW 97 >SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 37 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 95 Query: 891 XLGNW 905 G W Sbjct: 96 N-GEW 99 >SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 97 Query: 891 XLGNW 905 G W Sbjct: 98 N-GEW 101 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 117 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 175 Query: 891 XLGNW 905 G W Sbjct: 176 N-GEW 179 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 121 Query: 891 XLGNW 905 G W Sbjct: 122 N-GEW 125 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 96 Query: 891 XLGNW 905 G W Sbjct: 97 N-GEW 100 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/62 (53%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ KARTD PSQ L G Sbjct: 39 YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NNEKARTDRPSQQLRSLN-G 96 Query: 900 NW 905 W Sbjct: 97 EW 98 >SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 90 Query: 891 XLGNW 905 G W Sbjct: 91 N-GEW 94 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 121 Query: 891 XLGNW 905 G W Sbjct: 122 N-GEW 125 >SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 85 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 143 Query: 891 XLGNW 905 G W Sbjct: 144 N-GEW 147 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 142 Query: 891 XLGNW 905 G W Sbjct: 143 N-GEW 146 >SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 40 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 98 Query: 891 XLGNW 905 G W Sbjct: 99 N-GEW 102 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 90 Query: 891 XLGNW 905 G W Sbjct: 91 N-GEW 94 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 120 Query: 891 XLGNW 905 G W Sbjct: 121 N-GEW 124 >SB_16189| Best HMM Match : rve (HMM E-Value=0.3) Length = 595 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 493 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 551 Query: 891 XLGNW 905 G W Sbjct: 552 N-GEW 555 >SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 105 Query: 891 XLGNW 905 G W Sbjct: 106 N-GEW 109 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 85 Query: 891 XLGNW 905 G W Sbjct: 86 N-GEW 89 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 118 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 176 Query: 891 XLGNW 905 G W Sbjct: 177 N-GEW 180 >SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1593 Score = 48.4 bits (110), Expect = 9e-06 Identities = 36/79 (45%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = +3 Query: 675 RHFLRAXKXGGAGNQFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAX 848 R FL + N YSESY NSL R WE PGVTQLN L H PF+ + Sbjct: 144 RSFLERPPPRWSSNS-PYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSE 201 Query: 849 KARTDWPSQXFXPLXLGNW 905 +ARTD PSQ L G W Sbjct: 202 EARTDRPSQQLRSLN-GEW 219 >SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 101 Query: 891 XLGNW 905 G W Sbjct: 102 N-GEW 105 >SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 77 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 135 Query: 891 XLGNW 905 G W Sbjct: 136 N-GEW 139 >SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 105 Query: 891 XLGNW 905 G W Sbjct: 106 N-GEW 109 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 96 Query: 891 XLGNW 905 G W Sbjct: 97 N-GEW 100 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 100 Query: 891 XLGNW 905 G W Sbjct: 101 N-GEW 104 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 75 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 133 Query: 891 XLGNW 905 G W Sbjct: 134 N-GEW 137 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 151 Query: 891 XLGNW 905 G W Sbjct: 152 N-GEW 155 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 76 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 134 Query: 891 XLGNW 905 G W Sbjct: 135 N-GEW 138 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVDLQRPDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) Length = 160 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 116 Query: 891 XLGNW 905 G W Sbjct: 117 N-GEW 120 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 181 Query: 891 XLGNW 905 G W Sbjct: 182 N-GEW 185 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 113 Query: 891 XLGNW 905 G W Sbjct: 114 N-GEW 117 >SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 33 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 91 Query: 891 XLGNW 905 G W Sbjct: 92 N-GEW 95 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 97 Query: 891 XLGNW 905 G W Sbjct: 98 N-GEW 101 >SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 88 Query: 891 XLGNW 905 G W Sbjct: 89 N-GEW 92 >SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) Length = 271 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 227 Query: 891 XLGNW 905 G W Sbjct: 228 N-GEW 231 >SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 97 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 155 Query: 891 XLGNW 905 G W Sbjct: 156 N-GEW 159 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 250 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 308 Query: 891 XLGNW 905 G W Sbjct: 309 N-GEW 312 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 84 Query: 891 XLGNW 905 G W Sbjct: 85 N-GEW 88 >SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 99 Query: 891 XLGNW 905 G W Sbjct: 100 N-GEW 103 >SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 53 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 111 Query: 891 XLGNW 905 G W Sbjct: 112 N-GEW 115 >SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 85 Query: 891 XLGNW 905 G W Sbjct: 86 N-GEW 89 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 64 QFALYESYYNSLDVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 122 Query: 891 XLGNW 905 G W Sbjct: 123 N-GEW 126 >SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 104 Query: 891 XLGNW 905 G W Sbjct: 105 N-GEW 108 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 111 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 169 Query: 891 XLGNW 905 G W Sbjct: 170 N-GEW 173 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 101 Query: 891 XLGNW 905 G W Sbjct: 102 N-GEW 105 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 93 Query: 891 XLGNW 905 G W Sbjct: 94 N-GEW 97 >SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 113 Query: 891 XLGNW 905 G W Sbjct: 114 N-GEW 117 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 116 Query: 891 XLGNW 905 G W Sbjct: 117 N-GEW 120 >SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 92 Query: 891 XLGNW 905 G W Sbjct: 93 N-GEW 96 >SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 89 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 147 Query: 891 XLGNW 905 G W Sbjct: 148 N-GEW 151 >SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 113 Query: 891 XLGNW 905 G W Sbjct: 114 N-GEW 117 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRLDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 81 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 139 Query: 891 XLGNW 905 G W Sbjct: 140 N-GEW 143 >SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) Length = 188 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 48 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 106 Query: 891 XLGNW 905 G W Sbjct: 107 N-GEW 110 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 96 Query: 891 XLGNW 905 G W Sbjct: 97 N-GEW 100 >SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 90 Query: 891 XLGNW 905 G W Sbjct: 91 N-GEW 94 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 117 Query: 891 XLGNW 905 G W Sbjct: 118 N-GEW 121 >SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 87 Query: 891 XLGNW 905 G W Sbjct: 88 N-GEW 91 >SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 48 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 106 Query: 891 XLGNW 905 G W Sbjct: 107 N-GEW 110 >SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 89 Query: 891 XLGNW 905 G W Sbjct: 90 N-GEW 93 >SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 67 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 125 Query: 891 XLGNW 905 G W Sbjct: 126 N-GEW 129 >SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 33 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 91 Query: 891 XLGNW 905 G W Sbjct: 92 N-GEW 95 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 89 Query: 891 XLGNW 905 G W Sbjct: 90 N-GEW 93 >SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 97 Query: 891 XLGNW 905 G W Sbjct: 98 N-GEW 101 >SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 121 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 179 Query: 891 XLGNW 905 G W Sbjct: 180 N-GEW 183 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 97 Query: 891 XLGNW 905 G W Sbjct: 98 N-GEW 101 >SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 94 Query: 891 XLGNW 905 G W Sbjct: 95 N-GEW 98 >SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 82 Query: 891 XLGNW 905 G W Sbjct: 83 N-GEW 86 >SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 103 Query: 891 XLGNW 905 G W Sbjct: 104 N-GEW 107 >SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 100 Query: 891 XLGNW 905 G W Sbjct: 101 N-GEW 104 >SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 117 Query: 891 XLGNW 905 G W Sbjct: 118 N-GEW 121 >SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 96 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 154 Query: 891 XLGNW 905 G W Sbjct: 155 N-GEW 158 >SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 86 Query: 891 XLGNW 905 G W Sbjct: 87 N-GEW 90 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 82 Query: 891 XLGNW 905 G W Sbjct: 83 N-GEW 86 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 109 Query: 891 XLGNW 905 G W Sbjct: 110 N-GEW 113 >SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) Length = 174 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 130 Query: 891 XLGNW 905 G W Sbjct: 131 N-GEW 134 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 48.4 bits (110), Expect = 9e-06 Identities = 32/62 (51%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 726 YSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPLXLG 899 YSESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L G Sbjct: 89 YSESYYNSLAVILQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLN-G 146 Query: 900 NW 905 W Sbjct: 147 EW 148 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 88 Query: 891 XLGNW 905 G W Sbjct: 89 N-GEW 92 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 92 Query: 891 XLGNW 905 G W Sbjct: 93 N-GEW 96 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 86 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 144 Query: 891 XLGNW 905 G W Sbjct: 145 N-GEW 148 >SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 65 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 123 Query: 891 XLGNW 905 G W Sbjct: 124 N-GEW 127 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 277 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 335 Query: 891 XLGNW 905 G W Sbjct: 336 N-GEW 339 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 101 Query: 891 XLGNW 905 G W Sbjct: 102 N-GEW 105 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 113 Query: 891 XLGNW 905 G W Sbjct: 114 N-GEW 117 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 130 Query: 891 XLGNW 905 G W Sbjct: 131 N-GEW 134 >SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 89 Query: 891 XLGNW 905 G W Sbjct: 90 N-GEW 93 >SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 68 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 126 Query: 891 XLGNW 905 G W Sbjct: 127 N-GEW 130 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRPDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 93 Query: 891 XLGNW 905 G W Sbjct: 94 N-GEW 97 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 112 Query: 891 XLGNW 905 G W Sbjct: 113 N-GEW 116 >SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 117 Query: 891 XLGNW 905 G W Sbjct: 118 N-GEW 121 >SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 81 Query: 891 XLGNW 905 G W Sbjct: 82 N-GEW 85 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 101 Query: 891 XLGNW 905 G W Sbjct: 102 N-GEW 105 >SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 83 Query: 891 XLGNW 905 G W Sbjct: 84 N-GEW 87 >SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 109 Query: 891 XLGNW 905 G W Sbjct: 110 N-GEW 113 >SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 97 Query: 891 XLGNW 905 G W Sbjct: 98 N-GEW 101 >SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 84 Query: 891 XLGNW 905 G W Sbjct: 85 N-GEW 88 >SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 65 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 123 Query: 891 XLGNW 905 G W Sbjct: 124 N-GEW 127 >SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 124 Query: 891 XLGNW 905 G W Sbjct: 125 N-GEW 128 >SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 9e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 717 QFAYSESYXNSLXSF*SRX-WEKPGVTQLNAL-XHIPFSQVG*IAXKARTDWPSQXFXPL 890 QFA ESY NSL R WE PGVTQLN L H PF+ + +ARTD PSQ L Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 84 Query: 891 XLGNW 905 G W Sbjct: 85 N-GEW 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,555,781 Number of Sequences: 59808 Number of extensions: 666020 Number of successful extensions: 9843 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6653 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2943548647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -