Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0569.Seq
         (972 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g15730.1 68416.m01993 phospholipase D alpha 1 / PLD alpha 1 (...    28   8.1  

>At3g15730.1 68416.m01993 phospholipase D alpha 1 / PLD alpha 1
           (PLDALPHA1) (PLD1) / choline phosphatase 1 identical to
           SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4)
           (AtPLDalpha1) (PLD alpha 1) (Choline phosphatase 1)
           (Phosphatidylcholine-hydrolyzing phospholipase D 1)
           (PLDalpha) [Arabidopsis thaliana]
          Length = 810

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 2/37 (5%)
 Frame = +1

Query: 322 HEPNVRNCGSSRGGARYPIRPIVSRI--TIHWPSFYN 426
           H+PN      ++GG R P   I SR+   I W   YN
Sbjct: 387 HQPNFTGAAITKGGPREPWHDIHSRLEGPIAWDVMYN 423


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,163,798
Number of Sequences: 28952
Number of extensions: 411576
Number of successful extensions: 879
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 871
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2353558416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)