BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0569.Seq (972 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15730.1 68416.m01993 phospholipase D alpha 1 / PLD alpha 1 (... 28 8.1 >At3g15730.1 68416.m01993 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphatase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] Length = 810 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 322 HEPNVRNCGSSRGGARYPIRPIVSRI--TIHWPSFYN 426 H+PN ++GG R P I SR+ I W YN Sbjct: 387 HQPNFTGAAITKGGPREPWHDIHSRLEGPIAWDVMYN 423 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,163,798 Number of Sequences: 28952 Number of extensions: 411576 Number of successful extensions: 879 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2353558416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -