Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0566.Seq
         (891 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    23   4.3  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    22   7.4  

>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 10/36 (27%), Positives = 17/36 (47%)
 Frame = -1

Query: 243 KGQMERHRQLKRPPVRHKRQGQQRMQLIRC*CDGST 136
           K   E+  ++K+        G    +++RC C GST
Sbjct: 891 KATCEKLFRMKKSSALRPASGGTTARVVRCVCAGST 926


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -2

Query: 125 CGYHCRCRHQ 96
           CG +C C HQ
Sbjct: 562 CGQNCMCTHQ 571


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,507
Number of Sequences: 336
Number of extensions: 3318
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24720487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)