BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0566.Seq (891 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 1e-17 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 87 2e-17 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 87 2e-17 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 87 2e-17 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 79 6e-15 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 79 6e-15 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 79 6e-15 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 79 6e-15 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 79 6e-15 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 79 6e-15 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 79 6e-15 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 75 8e-14 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 75 8e-14 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 75 8e-14 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 75 8e-14 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 75 8e-14 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 75 8e-14 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 75 8e-14 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 75 8e-14 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 75 8e-14 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 75 8e-14 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 75 8e-14 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 75 8e-14 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 75 8e-14 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 75 8e-14 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 75 8e-14 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 75 8e-14 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 75 8e-14 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 75 8e-14 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 75 8e-14 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 75 8e-14 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 75 8e-14 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 75 8e-14 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 75 8e-14 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 75 8e-14 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 75 8e-14 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 75 8e-14 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 75 8e-14 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 75 8e-14 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 75 8e-14 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 75 8e-14 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 75 8e-14 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 75 8e-14 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 75 8e-14 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 75 8e-14 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 75 8e-14 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 75 8e-14 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 75 8e-14 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 75 8e-14 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 75 8e-14 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 73 2e-13 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 71 2e-12 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 69 7e-12 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 69 7e-12 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 69 7e-12 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 68 9e-12 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 68 9e-12 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 67 2e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 67 2e-11 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 67 2e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 67 2e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 67 2e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 67 2e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 67 2e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 67 2e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 67 2e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 67 2e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 67 2e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 67 2e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 67 2e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 67 2e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 67 2e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 67 2e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 67 2e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 67 2e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 67 2e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 67 2e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 67 2e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 67 2e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 67 2e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 67 2e-11 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 67 2e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 67 2e-11 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 67 2e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 67 2e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 67 2e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 67 2e-11 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 67 2e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 67 2e-11 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 67 2e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 67 2e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 67 2e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 67 2e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 67 2e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 67 2e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 67 2e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 67 2e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 67 2e-11 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 67 2e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 67 2e-11 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 67 2e-11 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 67 2e-11 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 67 2e-11 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 67 2e-11 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 67 2e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 66 3e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 66 3e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 66 3e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 66 3e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 66 3e-11 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 66 3e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 66 3e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 66 3e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 66 3e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 66 3e-11 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 66 3e-11 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_20259| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 65 6e-11 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 65 6e-11 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 65 8e-11 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 65 8e-11 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 65 8e-11 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 65 8e-11 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 65 8e-11 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 65 8e-11 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 65 8e-11 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 65 8e-11 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 65 8e-11 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 65 8e-11 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 65 8e-11 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 65 8e-11 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 65 8e-11 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 65 8e-11 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 87.8 bits (208), Expect = 1e-17 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = -3 Query: 565 KGQSVRASSLLRQLAKGGCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 407 +G+SVRASSLLRQLAKGGC GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 28 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGF 474 Q+RNCWEG + + G +ARRLSWVTPGF Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 58 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 87.0 bits (206), Expect = 2e-17 Identities = 43/60 (71%), Positives = 45/60 (75%) Frame = -3 Query: 586 FRCATVGKGQSVRASSLLRQLAKGGCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 407 FR +G+SVRASSLLRQLAKGGC GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 592 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 648 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRR----CKTT 447 HSPF++RNCWEG + + G +ARRLSW P +R C TT Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWGFPSHDVVKRRPVNCNTT 642 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 87.0 bits (206), Expect = 2e-17 Identities = 43/60 (71%), Positives = 45/60 (75%) Frame = -3 Query: 586 FRCATVGKGQSVRASSLLRQLAKGGCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 407 FR +G+SVRASSLLRQLAKGGC GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 35 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRR----CKTT 447 HSPF++RNCWEG + + G +ARRLSW P +R C TT Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWGFPSHDVVKRRPVNCNTT 85 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 87.0 bits (206), Expect = 2e-17 Identities = 43/60 (71%), Positives = 45/60 (75%) Frame = -3 Query: 586 FRCATVGKGQSVRASSLLRQLAKGGCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 407 FR +G+SVRASSLLRQLAKGGC GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 35 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRR----CKTT 447 HSPF++RNCWEG + + G +ARRLSW P +R C TT Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWGFPSHDVVKRRPVNCNTT 85 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASE 438 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASE Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 Score = 64.9 bits (151), Expect = 8e-11 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEW 597 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 76.2 bits (179), Expect = 3e-14 Identities = 34/58 (58%), Positives = 40/58 (68%) Frame = -3 Query: 580 CATVGKGQSVRASSLLRQLAKGGCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 407 CATVGKG ++ +G C + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 74.9 bits (176), Expect = 8e-14 Identities = 36/68 (52%), Positives = 44/68 (64%) Frame = -2 Query: 638 FNANFNKILTLTICHSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRR 459 F F+++ HSPF++RNC EG + + G +ARRLSWVTPGFSQSRR Sbjct: 31 FAIAFHRLKNQGASHSPFRLRNCGEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR 90 Query: 458 CKTTASEL 435 CKTTASEL Sbjct: 91 CKTTASEL 98 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 914 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 262 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 49.6 bits (113), Expect = 3e-06 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -1 Query: 585 SGAQLLGRANRCGPLRYYASWRKGDV 508 SG +G+ +RCGPLRYYASWRKGDV Sbjct: 89 SGCATVGKGDRCGPLRYYASWRKGDV 114 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 598 AIRHFRCATVGKGQSVRASSLLRQLAKGGCLQGD 497 AIRH CATVGKG KG LQGD Sbjct: 85 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 68 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 74.9 bits (176), Expect = 8e-14 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 73.3 bits (172), Expect = 2e-13 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTA 444 HSPF++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTA Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 Score = 61.7 bits (143), Expect = 8e-10 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEW 597 LAVVLQRRDWEN GVTQLNRLA P + ++ PSQQLR+ NGEW Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 566 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 72.9 bits (171), Expect = 3e-13 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -3 Query: 520 KGGCLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 407 KG LQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -2 Query: 590 PFQVRNCWEGPIGAGLFAITPAGERG 513 P Q IGAGLFAITPAGE+G Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKG 65 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 579 AQLLGRANRCGPLRYYASWRKGDVCKA-IKLGNARVFP 469 AQLLGRA G + KGDV + +KLG + FP Sbjct: 44 AQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFP 81 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 70.5 bits (165), Expect = 2e-12 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 HSPF++RN WEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 65 HSPFRLRNYWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 70.5 bits (165), Expect = 2e-12 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 H ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 236 HLTIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 70.1 bits (164), Expect = 2e-12 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 Q+RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 69.3 bits (162), Expect = 4e-12 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 410 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQTSP 517 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQ P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +1 Query: 502 LADIPLSPAGVIAKRPAPIGPSQQLRT*NGEW 597 L IPLSPAGVIA+ PSQQLR+ NGEW Sbjct: 64 LQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 68.5 bits (160), Expect = 7e-12 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 68.5 bits (160), Expect = 7e-12 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 68.5 bits (160), Expect = 7e-12 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 251 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 68.5 bits (160), Expect = 7e-12 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 193 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 68.5 bits (160), Expect = 7e-12 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 221 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 68.5 bits (160), Expect = 7e-12 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 592 RHFRCATVGKGQSVRASSLLRQLAKGGC 509 R R +G+SVRASSLLRQLAKGGC Sbjct: 387 RLHRLRNCWEGRSVRASSLLRQLAKGGC 414 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -2 Query: 581 VRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 +RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -2 Query: 581 VRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 +RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 358 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -2 Query: 581 VRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 +RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -2 Query: 581 VRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 +RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/55 (61%), Positives = 40/55 (72%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIV 606 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLRT NGEW+++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRLM 93 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -2 Query: 581 VRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 +RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -2 Query: 581 VRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 +RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 119 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -2 Query: 581 VRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASEL 435 +RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 83 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 67.7 bits (158), Expect = 1e-11 Identities = 34/58 (58%), Positives = 41/58 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVN 615 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ N Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/47 (68%), Positives = 34/47 (72%) Frame = +2 Query: 440 HWPSFYNVVTGKTLALPNLIALQTSPFRQLA**RRGPHRLALPNSCA 580 HWPSFYNVVTGKTLALPNLIALQ P + P +ALPNSCA Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 108 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 67.7 bits (158), Expect = 1e-11 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -2 Query: 596 HSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTAS 441 H+ Q+RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTAS Sbjct: 160 HTLNQLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 211 Score = 64.9 bits (151), Expect = 8e-11 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEW 597 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/47 (68%), Positives = 34/47 (72%) Frame = +2 Query: 440 HWPSFYNVVTGKTLALPNLIALQTSPFRQLA**RRGPHRLALPNSCA 580 HWPSFYNVVTGKTLALPNLIALQ P + P +ALPNSCA Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 103 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 67.3 bits (157), Expect = 2e-11 Identities = 35/65 (53%), Positives = 43/65 (66%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 892 Query: 622 LKFAL 636 L Sbjct: 893 THLIL 897 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 67.3 bits (157), Expect = 2e-11 Identities = 38/78 (48%), Positives = 47/78 (60%) Frame = +1 Query: 388 RGGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPS 567 RGG P+ LAVVLQRRDWENPGVTQLNRLA P + ++ PS Sbjct: 84 RGGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 141 Query: 568 QQLRT*NGEWQIVSVNIL 621 QQLR+ NGEW+++ +L Sbjct: 142 QQLRSLNGEWRLMRYFLL 159 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 67.3 bits (157), Expect = 2e-11 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = +2 Query: 425 SRITIHWPSFYNVVTGKTLALPNLIALQTSPFRQLA**RRGPHRLALP 568 SRITIHWPSFYNVVTGKTLALPNLIALQ P + P +ALP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 49 Score = 51.6 bits (118), Expect = 8e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 502 LADIPLSPAGVIAKRPAPIGPSQQLRT*NGEW 597 L IPLSPAGVIAKRPAPI +QLR+ NGEW Sbjct: 28 LQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/62 (54%), Positives = 42/62 (67%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ + Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVR 159 Query: 622 LK 627 K Sbjct: 160 AK 161 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 102 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 135 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 150 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 193 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 117 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 82 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 711 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 220 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 244 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 503 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 325 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 133 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 127 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 146 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 66.9 bits (156), Expect = 2e-11 Identities = 33/65 (50%), Positives = 41/65 (63%) Frame = -2 Query: 635 NANFNKILTLTICHSPFQVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRC 456 N FN + + +P ++RNCWEG + + G +ARRLSWVTPGFSQSRRC Sbjct: 470 NNGFNALHHAALRGNP-RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRC 528 Query: 455 KTTAS 441 KTTAS Sbjct: 529 KTTAS 533 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 153 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 226 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 164 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 95 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 178 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 211 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 161 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 66.9 bits (156), Expect = 2e-11 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = -2 Query: 584 QVRNCWEGPIGAGLFAITPAGERGMSARRLSWVTPGFSQSRRCKTTASE 438 ++RNCWEG + + G +ARRLSWVTPGFSQSRRCKTTASE Sbjct: 530 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 166 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 365 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 111 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 74 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 115 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 306 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 263 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 778 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +1 Query: 442 LAVVLQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQLRT*NGEWQIVSVNIL 621 LAVVLQRRDWENPGVTQLNRLA P + ++ PSQQLR+ NGEW+++ +L Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 246 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,643,051 Number of Sequences: 59808 Number of extensions: 447476 Number of successful extensions: 11788 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6569 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -