BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0566.Seq (891 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF145624-1|AAD38599.1| 918|Drosophila melanogaster BcDNA.GH0480... 29 6.5 AE013599-921|AAF58903.1| 918|Drosophila melanogaster CG1688-PA ... 29 6.5 >AF145624-1|AAD38599.1| 918|Drosophila melanogaster BcDNA.GH04802 protein. Length = 918 Score = 29.5 bits (63), Expect = 6.5 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 237 QMERHRQLKR---PPVRHKRQGQQRMQLIRC*CDGSTESLLRLPLQVPP 100 Q+++ +QL P H+ Q QQ+ Q ++ S+LR+PL VPP Sbjct: 382 QLQQQQQLSTATLPRQHHQMQLQQQQQQLQQNFVAVPSSMLRMPLTVPP 430 >AE013599-921|AAF58903.1| 918|Drosophila melanogaster CG1688-PA protein. Length = 918 Score = 29.5 bits (63), Expect = 6.5 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 237 QMERHRQLKR---PPVRHKRQGQQRMQLIRC*CDGSTESLLRLPLQVPP 100 Q+++ +QL P H+ Q QQ+ Q ++ S+LR+PL VPP Sbjct: 382 QLQQQQQLSTATLPRQHHQMQLQQQQQQLQQNFVAVPSSMLRMPLTVPP 430 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,869,050 Number of Sequences: 53049 Number of extensions: 664188 Number of successful extensions: 1633 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1633 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4352837424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -