BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0566.Seq (891 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098500-1|AAC67400.2| 311|Caenorhabditis elegans Hypothetical ... 31 1.5 Z81449-4|CAB03765.1| 811|Caenorhabditis elegans Hypothetical pr... 29 4.5 >AF098500-1|AAC67400.2| 311|Caenorhabditis elegans Hypothetical protein F43B10.1 protein. Length = 311 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = +1 Query: 454 LQRRDWENPGVTQLNRLADIPLSPAGVIAKRPAPIGPSQQL 576 L+R+ E+P T LN LA I PA +IAK+ + PSQ L Sbjct: 211 LRRKSIESPR-TFLNGLAGIESLPAVIIAKKDNNVNPSQIL 250 >Z81449-4|CAB03765.1| 811|Caenorhabditis elegans Hypothetical protein C46F11.4 protein. Length = 811 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 740 EQQXNPXPGXILWNYKDFADXRPNG*KNELI*QKFNANF 624 EQ G I+W++K D P+ +++ QKFN NF Sbjct: 191 EQLEYDEDGNIIWSWKKVIDPLPDIDHSQIQYQKFNKNF 229 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,329,482 Number of Sequences: 27780 Number of extensions: 321313 Number of successful extensions: 740 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2255353870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -