BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0558.Seq (949 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30068| Best HMM Match : MoeA_C (HMM E-Value=2.9e-15) 35 0.084 SB_19076| Best HMM Match : HECT (HMM E-Value=0) 30 3.1 >SB_30068| Best HMM Match : MoeA_C (HMM E-Value=2.9e-15) Length = 158 Score = 35.1 bits (77), Expect = 0.084 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = +3 Query: 390 GNPVSATLTFYQLVQPLLAKLSGNTASGLPARQLXHSVPPKKTPGRLDFQRGVLQRNAD 566 GNPVSA +TFY V P L KL+G+ L + + + P R ++ R VL D Sbjct: 48 GNPVSAMVTFYLFVLPALRKLAGHQFPHLTKIKAKLAKSVRLDP-RPEYHRAVLSWQPD 105 >SB_19076| Best HMM Match : HECT (HMM E-Value=0) Length = 2018 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 170 LSATIPMPCAPHLLKPTARR 229 L +P+ C PHLL P ARR Sbjct: 1374 LEEALPLACQPHLLHPNARR 1393 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,214,815 Number of Sequences: 59808 Number of extensions: 572091 Number of successful extensions: 1398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1397 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2776707833 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -