BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0557.Seq (859 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.3 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 24 1.8 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 24 1.8 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 23 3.1 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 247 SPRPSVATGLAPSTGKRPRSRRTWTG 170 +P P+ G P PRS+R +TG Sbjct: 262 APSPTAGAGGLPPQVPSPRSQRRYTG 287 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 762 HRPE*TVFFALLNVWSPRSLNSGLLFQNGTTLNP 661 H P +VF A N P ++SG++ +GT L P Sbjct: 55 HMPPHSVF-AANNAEFPEFVHSGMVHNDGTQLMP 87 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 762 HRPE*TVFFALLNVWSPRSLNSGLLFQNGTTLNP 661 H P +VF A N P ++SG++ +GT L P Sbjct: 55 HMPPHSVF-AANNAEFPEFVHSGMVHNDGTQLMP 87 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 23.0 bits (47), Expect = 3.1 Identities = 20/77 (25%), Positives = 26/77 (33%) Frame = -3 Query: 272 QPDSKEVPLAATLRRYGPGTLYGKTAPFKTNLDRSRRDEKAEPPEHHISRYRLKQRDSVL 93 QP + P L YG G Y A K S KA EH + Y K +L Sbjct: 61 QPTTGYYPYDPALAAYGYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIML 120 Query: 92 GYIPVRSPLLRKSWLVS 42 I + +W + Sbjct: 121 AIITKMTLTQVSTWFAN 137 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,581 Number of Sequences: 336 Number of extensions: 4384 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -