BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ps4M0557.Seq
(859 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. 30 9.4
>AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein.
Length = 1857
Score = 30.3 bits (65), Expect = 9.4
Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
Frame = +3
Query: 369 RITIHWP-SFYNVVTGKTXALPNLIALQHIPLSPAGVIAKRPAPIALPTVAHLNGEW 536
R+ WP S +TGK A +L+ + +P G K P P+A P + W
Sbjct: 1749 RVRGWWPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSW 1805
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,722,584
Number of Sequences: 237096
Number of extensions: 3113777
Number of successful extensions: 7282
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6808
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7281
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10928473528
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -