BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0554.Seq (947 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 2.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 7.7 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 25.4 bits (53), Expect = 2.5 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -3 Query: 582 RLDSTSNARFGMLSRKNKLQSNVLGNFPNRSEVSELSSQGTSRRTL 445 R D+T + ++G LS S P+RS+ E R+ L Sbjct: 620 REDTTGSYKYGKLSSSGGASSTTHSGAPSRSQSDEDEQHSVGRKGL 665 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 7.7 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +3 Query: 531 YFYD*AYQNARWRLSRVELSSCERLKIRVXXXXXXTSLNRGTGC 662 Y+YD + RL+R+ELSS + + + T C Sbjct: 589 YYYDPLVEGKGDRLARIELSSGSSVSFKYSEQNKLVNFKVNTTC 632 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 856,712 Number of Sequences: 2352 Number of extensions: 16512 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 103776201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -