BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0554.Seq (947 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92813-2|CAB07284.1| 353|Caenorhabditis elegans Hypothetical pr... 30 2.8 Z68296-3|CAB54197.2| 223|Caenorhabditis elegans Hypothetical pr... 28 8.5 >Z92813-2|CAB07284.1| 353|Caenorhabditis elegans Hypothetical protein T28A8.2 protein. Length = 353 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 274 KEFQMSNLELNKYYQN*IINNARIMHRSRTLHNNIIYFHLRSTYYLDIDR 423 ++F SN ++K N I A I+ SR LH + F STY ++R Sbjct: 44 RKFISSNFAVSKQLGNNIFELASILGISRVLHRTPVIFLQNSTYQYMLNR 93 >Z68296-3|CAB54197.2| 223|Caenorhabditis elegans Hypothetical protein C46C2.5 protein. Length = 223 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 536 KINSNQTSLEIFLTGVK*ANCQVKVRRDVP*TF 438 K+ NQ L+IFL NC V V D+P F Sbjct: 6 KLTDNQEMLKIFLIFTVLINCTVSVPADIPSLF 38 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,691,381 Number of Sequences: 27780 Number of extensions: 351585 Number of successful extensions: 700 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2454664212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -