BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0552.Seq (920 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 3.2 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 7.5 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 3.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 446 FARLLPSLDVVAVSQAPSPESTLIPRY 526 +A L SLD+ A+ P PE IP + Sbjct: 683 YANQLTSLDIKALRLQPVPEDKQIPEF 709 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 7.5 Identities = 17/69 (24%), Positives = 24/69 (34%) Frame = -3 Query: 918 ILTNFTVKXCHSPFXXXKXLGRXIXCGPXXXYPQXAKRGXSARRLSWVTPGFPSHELCKN 739 +L NF + H P+ + + R C YP A R + L K Sbjct: 435 VLKNFPTRFIHEPWNASESVQRAAKCLIGKDYPLPMVNHAIASRANMERIKQVYQHLAKY 494 Query: 738 RRPSEX*YD 712 R PS Y+ Sbjct: 495 RTPSGGCYE 503 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 915,427 Number of Sequences: 2352 Number of extensions: 18266 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100055142 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -