BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0549.Seq (950 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17655| Best HMM Match : ArfGap (HMM E-Value=0.015) 51 1e-06 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 33 0.26 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_24571| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 31 1.8 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_32293| Best HMM Match : BRCA2 (HMM E-Value=0) 30 2.4 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 3.2 SB_49526| Best HMM Match : HSBP1 (HMM E-Value=0.28) 29 4.2 SB_24132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_13719| Best HMM Match : HSBP1 (HMM E-Value=0.28) 29 4.2 SB_2790| Best HMM Match : HSBP1 (HMM E-Value=0.15) 29 4.2 SB_58227| Best HMM Match : HSBP1 (HMM E-Value=0.28) 29 4.2 SB_52992| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_26652| Best HMM Match : HSBP1 (HMM E-Value=0.28) 29 5.5 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_43428| Best HMM Match : Glyco_hydro_47 (HMM E-Value=0) 29 7.3 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 28 9.6 SB_39407| Best HMM Match : TIG (HMM E-Value=0) 28 9.6 SB_20803| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-06) 28 9.6 >SB_17655| Best HMM Match : ArfGap (HMM E-Value=0.015) Length = 401 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = -3 Query: 522 LQSEDVNLDS--WTPEQVVSLQQMGNSRARAVYEANLPDSFRRPQNDMSLESFIRAKYXQ 349 L+ V+L S W Q R + FRRPQ D ++E+FIR KY Q Sbjct: 65 LELGSVHLHSLRWNSSQFRGTHLKSKIRQLGFVDGRANGDFRRPQTDSAMEAFIRKKYEQ 124 Query: 348 KKYIAKEWVPPQ 313 KK+I K+ +PPQ Sbjct: 125 KKFIKKDGLPPQ 136 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = -3 Query: 513 EDVNLDSWTPEQVVSLQQMGNSRARAVYEANLPDSFRRPQ-NDMSL--ESFIRAKYXQKK 343 + + LD+WT E++ + + GN ++ A++ N+P +RRP+ D + E +IRAKY +K+ Sbjct: 58 KSLRLDTWTDERLQFMIENGNEKSNAIWAKNVPICYRRPKCTDPHVLREQWIRAKYERKE 117 Query: 342 YI 337 +I Sbjct: 118 FI 119 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = -1 Query: 626 CVDCDAKGSTMGFMEFGYIPVXSCAGIHRNLGVHISKVK 510 C DC AK G +C+G+HRNLG IS VK Sbjct: 20 CADCGAKHPEWASASKGIFICITCSGVHRNLGTQISVVK 58 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 626 CVDCDAKGSTMGFMEFGYIPVXSCAGIHRNLGVHISKVK 510 C DC +K T G + C+G+HR +GVH+S+V+ Sbjct: 101 CADCTSKDPTWLSTNLGVLTCIECSGVHRGMGVHVSRVQ 139 >SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Frame = -3 Query: 507 VNLDSWTPEQVVSLQQMGNSRARAVYEANLPDSFRR---PQNDMSLESFIRAKYXQKKYI 337 + LD+W PE + + ++GNS ++YEA + ++ N E++I++KY +++ Sbjct: 311 LTLDAWEPEHLKLMSELGNSLINSIYEAKIAGDHKKINHLSNRSDREAWIKSKYIYHRFV 370 Query: 336 A 334 + Sbjct: 371 S 371 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 483 EQVVSLQQMGNSRARAVYEANLPDSFR-RPQNDMS-LESFIRAKYXQKKY 340 E VV + ++GN A + E +PD R RP D + FI AKY KKY Sbjct: 870 EIVVLMVKIGNENANKLLEFKIPDDDRIRPDADSAKRREFICAKYEYKKY 919 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF +V GKTL + Q RL +P Sbjct: 2 SRITIHWPSFYNVV-TGKTLSVTQLNRLAAHP 32 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNPLLP 926 S T HWPSF +V GKTL L L+ PL P Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALQHIPLSP 35 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNPLLP 926 S T HWPSF +V GKTL L L+ PL P Sbjct: 80 SRITIHWPSFYNVV-TGKTLALPNLIALQHIPLSP 113 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNPLLP 926 S T HWPSF +V GKTL L L+ PL P Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALQHIPLSP 35 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +3 Query: 837 HWPSFLXIVKLGKTLXLAQFXRLEQNPLLPTLGKN 941 HWPSF +V GKTL L L+ PL P G+N Sbjct: 5 HWPSFYNVV-TGKTLALPNLIALQHIPLSPA-GRN 37 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 837 HWPSFLXIVKLGKTLXLAQFXRLEQNP 917 HWPSF +V GKTL + Q RL +P Sbjct: 5 HWPSFYNVV-TGKTLGVTQLNRLAAHP 30 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 Query: 837 HWPSFLXIVKLGKTLXLAQFXRLEQNPLLP 926 HWPSF +V GKTL L L+ PL P Sbjct: 62 HWPSFYNVV-TGKTLALPNLIALQHIPLSP 90 >SB_24571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 868 Score = 31.5 bits (68), Expect = 1.0 Identities = 30/118 (25%), Positives = 48/118 (40%), Gaps = 1/118 (0%) Frame = -1 Query: 683 GSLSEYISANA*XXKATXLCVDCDAKGSTMGFMEFGYIPVXSCAGIHRNLGVHISKVKM- 507 G+L+ +++ A A C ++G T GF GY C H + VH+ Sbjct: 79 GALARHVNT-AGTASADTRCQHRCSRGPTSGFPPEGYAHWRVC---HPRVDVHLKACHFF 134 Query: 506 SISIRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLR 333 S + Q + + + T+ P TR Y R + + WNR N ++ TLR Sbjct: 135 SNQVVAPQMEGPQGMERITSPEQPATRTKYSGRVEAGRRLAKWNRL---NRAKKETLR 189 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 Query: 837 HWPSFLXIVKLGKTLXLAQFXRLEQNPLLP 926 HWPSF +V GKTL L L+ PL P Sbjct: 57 HWPSFYNVV-TGKTLALPNLIALQHIPLSP 85 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = -3 Query: 513 EDVNLDSWTPEQVVSLQQMGNSRARAVYEANLPDSFRRPQNDMSLESFIRAKYXQKKYIA 334 + +++ S+TP+++ LQ GN + + L +S P+ + E ++ + +KY Sbjct: 65 KSISMTSFTPQEIEYLQGAGNEVCKKTW-LGLWNSANNPEPESRDEQKVK-DFMIQKYER 122 Query: 333 KEW-VPPQLPKV 301 + W +PPQ V Sbjct: 123 RRWYIPPQQASV 134 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 626 CVDCDAKGSTMGFMEFGYIPVXSCAGIHRNL 534 C DC +G T M G SC+GI R L Sbjct: 28 CFDCGQRGPTYVNMTIGSFVCTSCSGILRGL 58 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF +V GKTL L L+ +P Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALQLHP 32 >SB_32293| Best HMM Match : BRCA2 (HMM E-Value=0) Length = 1649 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 105 RTPAKRPTVRRSPRLGHRQTGPRAQQRSSCRIRHE 1 +TP + PT +PRLG+ + PR QRSS +R + Sbjct: 1559 QTPVQTPT---APRLGYDEMMPREIQRSSAALRED 1590 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNPL 920 S T HWPSF +V GKTL L L PL Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLFDLRHIPL 33 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF +V GKTL L L+ P Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALQHIP 32 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF +V GKTL L L +P Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALAAHP 32 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 935 TQXWQKGILFKXXKLG*XQGFPQFNDX*KXRPVXCXRT 822 T ++G+ K KLG +GFP +D K RPV C T Sbjct: 56 TPAGERGMCCKAIKLGNARGFPS-HDGEKRRPVNCNTT 92 >SB_49526| Best HMM Match : HSBP1 (HMM E-Value=0.28) Length = 469 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_24132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_13719| Best HMM Match : HSBP1 (HMM E-Value=0.28) Length = 335 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_2790| Best HMM Match : HSBP1 (HMM E-Value=0.15) Length = 263 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_58227| Best HMM Match : HSBP1 (HMM E-Value=0.28) Length = 565 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_52992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF +V GK + Q RL +P Sbjct: 2 SRITIHWPSFYNVV-TGKNTGVTQLNRLAAHP 32 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF +V GK + Q RL +P Sbjct: 2 SRITIHWPSFYNVV-TGKNTGVTQLNRLAAHP 32 >SB_651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_26652| Best HMM Match : HSBP1 (HMM E-Value=0.28) Length = 335 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN +R SG P Sbjct: 69 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YFENQSRRNNIRVSGIP 125 Query: 317 RS 312 S Sbjct: 126 ES 127 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF ++ L KT + Q RL +P Sbjct: 2 SRITIHWPSFYNVM-LAKTPGVTQLNRLAAHP 32 >SB_43428| Best HMM Match : Glyco_hydro_47 (HMM E-Value=0) Length = 758 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/61 (24%), Positives = 30/61 (49%) Frame = -3 Query: 492 WTPEQVVSLQQMGNSRARAVYEANLPDSFRRPQNDMSLESFIRAKYXQKKYIAKEWVPPQ 313 W VS++Q+ N + + + NL + +++M E+ + KKY+ + PP+ Sbjct: 209 WDTRTDVSIEQIKNHKPHDISDDNLIPLRKPDRDEMFRENMKEYEEQAKKYVKPKKGPPK 268 Query: 312 L 310 L Sbjct: 269 L 269 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 822 SPXTXHWPSFLXIVKLGKTLXLAQFXRLEQNP 917 S T HWPSF +V GK + Q RL +P Sbjct: 2 SRITIHWPSFYNVV-TGKNPGVTQLNRLAAHP 32 >SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 855 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = -2 Query: 697 AKQLQDRCQNILVQMLKXXRQXNYAL-TVMQKVPRWASWNLGIFLXIPALGSIGIWVFTS 521 A+QLQ++CQ V + A TV Q V ++++ +G+ + G+W + Sbjct: 385 ARQLQEKCQEQNVDLYSTYVDLTKAFDTVKQNVDLYSTY-VGLTKAFDTVSREGLWKIMA 443 Query: 520 PK*RCQSRFVD 488 K C S+F++ Sbjct: 444 -KFGCPSKFIN 453 >SB_39407| Best HMM Match : TIG (HMM E-Value=0) Length = 1710 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/66 (30%), Positives = 33/66 (50%) Frame = -3 Query: 573 YSCXFLRWDPSESGCSHLQSEDVNLDSWTPEQVVSLQQMGNSRARAVYEANLPDSFRRPQ 394 Y+ W P+ S L++ +LD+ V++ Q N+R+R VY+ F P+ Sbjct: 346 YAGEMTTWLPTNISDSDLEAALNSLDALRDMGNVTVTQSSNNRSR-VYKVGF--VFENPE 402 Query: 393 NDMSLE 376 + MSLE Sbjct: 403 DAMSLE 408 >SB_20803| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-06) Length = 563 Score = 28.3 bits (60), Expect = 9.6 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 2/87 (2%) Frame = -1 Query: 497 IRGLQSKWCRYSKWETAAPGPCTRRTYQTRSDVHKTTCPWNRSYAPNTXRRNTLRRSGCP 318 + GL++ +++ E GP ++ +T S+V K Y N RRN R SG P Sbjct: 37 VSGLKAS-LEFTQSEVERFGPINKKVKETDSEVVKVKDALE--YLENQSRRNNKRVSGIP 93 Query: 317 RSCPKS-TGIKK*TKRWIDRK-GKEVG 243 S +S + K+ I K G E+G Sbjct: 94 ESPGESWADSEAKVKKAIQTKLGLEIG 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,044,835 Number of Sequences: 59808 Number of extensions: 552844 Number of successful extensions: 1802 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1794 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2788625034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -