BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0543.Seq (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 87 2e-17 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 86 4e-17 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 86 4e-17 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 86 4e-17 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 86 4e-17 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 86 4e-17 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 86 4e-17 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 86 4e-17 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 86 4e-17 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 86 4e-17 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 86 4e-17 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 86 4e-17 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 86 4e-17 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 86 4e-17 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 86 4e-17 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 86 4e-17 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 86 4e-17 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 86 4e-17 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 86 4e-17 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 86 4e-17 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 86 4e-17 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 86 4e-17 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 86 4e-17 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 86 4e-17 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 86 4e-17 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 86 4e-17 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 86 4e-17 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 86 4e-17 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 86 4e-17 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 86 4e-17 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 86 4e-17 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 86 4e-17 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 86 4e-17 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 86 4e-17 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 86 4e-17 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 86 4e-17 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 86 4e-17 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 86 4e-17 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 86 4e-17 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 86 4e-17 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 86 4e-17 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 86 4e-17 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 86 4e-17 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 86 4e-17 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 86 4e-17 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 86 4e-17 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 85 7e-17 SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 85 7e-17 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 83 3e-16 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 83 3e-16 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 83 3e-16 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 83 3e-16 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 83 3e-16 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 83 3e-16 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 83 3e-16 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 83 3e-16 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 83 3e-16 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 83 3e-16 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 83 3e-16 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 83 3e-16 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 83 3e-16 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 83 3e-16 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 83 3e-16 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 83 3e-16 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 83 3e-16 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 83 3e-16 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 83 3e-16 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 83 3e-16 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 83 3e-16 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 83 3e-16 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 83 3e-16 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 83 3e-16 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 83 3e-16 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 83 3e-16 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 83 3e-16 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 83 3e-16 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 83 3e-16 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 83 3e-16 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 83 3e-16 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 83 3e-16 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 83 3e-16 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 83 3e-16 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 83 3e-16 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 83 3e-16 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 83 3e-16 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 83 3e-16 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 83 3e-16 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 83 3e-16 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 83 3e-16 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 83 3e-16 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 83 3e-16 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 83 3e-16 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 83 3e-16 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 83 3e-16 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 83 3e-16 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 83 3e-16 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 83 3e-16 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 83 3e-16 SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28658| Best HMM Match : I-set (HMM E-Value=1.5) 83 3e-16 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26211| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26011| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 83 3e-16 SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25260| Best HMM Match : PqiA (HMM E-Value=0.3) 83 3e-16 SB_25256| Best HMM Match : G-patch (HMM E-Value=3.7) 83 3e-16 SB_25128| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 83 3e-16 SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_23634| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22975| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22925| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22609| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_21773| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 89.8 bits (213), Expect = 2e-18 Identities = 40/59 (67%), Positives = 41/59 (69%) Frame = -2 Query: 649 QLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTAVNCNTTHYRANW 473 QLRNCWEG S + QLAKGGCAARRLSWVTP F K VNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 86.6 bits (205), Expect = 2e-17 Identities = 40/59 (67%), Positives = 42/59 (71%) Frame = -2 Query: 685 NINAYNLPIRPFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 NI PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 253 NITIQGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 311 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 474 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 522 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 218 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 266 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 67 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 115 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 648 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 696 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 373 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 421 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 289 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 337 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 557 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 605 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 181 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 Score = 81.4 bits (192), Expect = 9e-16 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = +3 Query: 510 AVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*NG 656 AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS NG Sbjct: 516 AVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 564 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 Score = 81.4 bits (192), Expect = 9e-16 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = +3 Query: 510 AVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*NG 656 AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS NG Sbjct: 86 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 134 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 29 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 77 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 82 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 13 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 190 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 238 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 447 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 495 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 282 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 330 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 132 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 180 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 916 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 964 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 583 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 631 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 264 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 312 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 497 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 545 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 181 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -3 Query: 654 HFSCATVGKGXXVRASSLLPSWRKGDVLQGD 562 H CATVGKG SWRKGDVLQGD Sbjct: 88 HSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 70 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 118 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 85.8 bits (203), Expect = 4e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 655 PFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 PF+LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 85.0 bits (201), Expect = 7e-17 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = -2 Query: 682 INAYNLPIRPFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 ++ Y++ R +LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 1094 VHGYDVTARRGRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 1151 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 85.0 bits (201), Expect = 7e-17 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = +3 Query: 3 VPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 170 VP+P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 66 VPVPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 62.5 bits (145), Expect = 4e-10 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 281 HLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFP 382 HLDK QQTTI+HK++TF +VYKKLTG++V FEFP Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 83.8 bits (198), Expect = 2e-16 Identities = 42/61 (68%), Positives = 45/61 (73%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW +++ D PSQQLRS N Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLN 106 Query: 654 G 656 G Sbjct: 107 G 107 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 83.4 bits (197), Expect = 2e-16 Identities = 42/61 (68%), Positives = 45/61 (73%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW +++ D PSQQLRS N Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEQARTDRPSQQLRSLN 84 Query: 654 G 656 G Sbjct: 85 G 85 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 654 G 656 G Sbjct: 84 G 84 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 654 G 656 G Sbjct: 85 G 85 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 110 Query: 654 G 656 G Sbjct: 111 G 111 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 654 G 656 G Sbjct: 87 G 87 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 118 Query: 654 G 656 G Sbjct: 119 G 119 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 654 G 656 G Sbjct: 95 G 95 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 101 Query: 654 G 656 G Sbjct: 102 G 102 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 117 Query: 654 G 656 G Sbjct: 118 G 118 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 654 G 656 G Sbjct: 106 G 106 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 131 Query: 654 G 656 G Sbjct: 132 G 132 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 92 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 151 Query: 654 G 656 G Sbjct: 152 G 152 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 191 Query: 654 G 656 G Sbjct: 192 G 192 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 49 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 108 Query: 654 G 656 G Sbjct: 109 G 109 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 654 G 656 G Sbjct: 83 G 83 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 121 Query: 654 G 656 G Sbjct: 122 G 122 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 24 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 654 G 656 G Sbjct: 84 G 84 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 654 G 656 G Sbjct: 105 G 105 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 117 Query: 654 G 656 G Sbjct: 118 G 118 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 654 G 656 G Sbjct: 99 G 99 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 83.0 bits (196), Expect = 3e-16 Identities = 38/55 (69%), Positives = 40/55 (72%) Frame = -2 Query: 673 YNLPIRPFQLRNCWEGXSGAGLFAITQLAKGGCAARRLSWVTPXFSQSRRCKTTA 509 Y +P LRNCWEG S + QLAKGGCAARRLSWVTP FSQSRRCKTTA Sbjct: 359 YRATGKPVVLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 413 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 654 G 656 G Sbjct: 86 G 86 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 90 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 149 Query: 654 G 656 G Sbjct: 150 G 150 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 654 G 656 G Sbjct: 107 G 107 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 654 G 656 G Sbjct: 94 G 94 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 654 G 656 G Sbjct: 103 G 103 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 654 G 656 G Sbjct: 85 G 85 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 103 Query: 654 G 656 G Sbjct: 104 G 104 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 57 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 116 Query: 654 G 656 G Sbjct: 117 G 117 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 100 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 159 Query: 654 G 656 G Sbjct: 160 G 160 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 654 G 656 G Sbjct: 116 G 116 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 150 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 209 Query: 654 G 656 G Sbjct: 210 G 210 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 100 Query: 654 G 656 G Sbjct: 101 G 101 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 90 Query: 654 G 656 G Sbjct: 91 G 91 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 654 G 656 G Sbjct: 83 G 83 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 89 Query: 654 G 656 G Sbjct: 90 G 90 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 79 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 138 Query: 654 G 656 G Sbjct: 139 G 139 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 98 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 157 Query: 654 G 656 G Sbjct: 158 G 158 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 654 G 656 G Sbjct: 107 G 107 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 654 G 656 G Sbjct: 85 G 85 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 143 Query: 654 G 656 G Sbjct: 144 G 144 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 31 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 90 Query: 654 G 656 G Sbjct: 91 G 91 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 654 G 656 G Sbjct: 92 G 92 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 654 G 656 G Sbjct: 87 G 87 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 136 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 195 Query: 654 G 656 G Sbjct: 196 G 196 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 103 Query: 654 G 656 G Sbjct: 104 G 104 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 654 G 656 G Sbjct: 106 G 106 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 654 G 656 G Sbjct: 87 G 87 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 90 Query: 654 G 656 G Sbjct: 91 G 91 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 654 G 656 G Sbjct: 105 G 105 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 654 G 656 G Sbjct: 99 G 99 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 115 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 174 Query: 654 G 656 G Sbjct: 175 G 175 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 157 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 216 Query: 654 G 656 G Sbjct: 217 G 217 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 654 G 656 G Sbjct: 85 G 85 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 131 Query: 654 G 656 G Sbjct: 132 G 132 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 397 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 456 Query: 654 G 656 G Sbjct: 457 G 457 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 654 G 656 G Sbjct: 106 G 106 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 89 Query: 654 G 656 G Sbjct: 90 G 90 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 137 Query: 654 G 656 G Sbjct: 138 G 138 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 452 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 511 Query: 654 G 656 G Sbjct: 512 G 512 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 654 G 656 G Sbjct: 103 G 103 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 654 G 656 G Sbjct: 88 G 88 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 654 G 656 G Sbjct: 83 G 83 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 91 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 150 Query: 654 G 656 G Sbjct: 151 G 151 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 654 G 656 G Sbjct: 116 G 116 >SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 137 Query: 654 G 656 G Sbjct: 138 G 138 >SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 95 Query: 654 G 656 G Sbjct: 96 G 96 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 45 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 654 G 656 G Sbjct: 105 G 105 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 654 G 656 G Sbjct: 87 G 87 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 118 Query: 654 G 656 G Sbjct: 119 G 119 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 120 Query: 654 G 656 G Sbjct: 121 G 121 >SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 95 Query: 654 G 656 G Sbjct: 96 G 96 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 182 Query: 654 G 656 G Sbjct: 183 G 183 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 228 Query: 654 G 656 G Sbjct: 229 G 229 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 125 Query: 654 G 656 G Sbjct: 126 G 126 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 101 Query: 654 G 656 G Sbjct: 102 G 102 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 229 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 288 Query: 654 G 656 G Sbjct: 289 G 289 >SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) Length = 148 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 46 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 654 G 656 G Sbjct: 106 G 106 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 99 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 158 Query: 654 G 656 G Sbjct: 159 G 159 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 654 G 656 G Sbjct: 94 G 94 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 45 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 654 G 656 G Sbjct: 105 G 105 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 654 G 656 G Sbjct: 94 G 94 >SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 654 G 656 G Sbjct: 86 G 86 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 76 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 135 Query: 654 G 656 G Sbjct: 136 G 136 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 125 Query: 654 G 656 G Sbjct: 126 G 126 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 110 Query: 654 G 656 G Sbjct: 111 G 111 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 120 Query: 654 G 656 G Sbjct: 121 G 121 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 117 Query: 654 G 656 G Sbjct: 118 G 118 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 102 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 161 Query: 654 G 656 G Sbjct: 162 G 162 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 73 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 132 Query: 654 G 656 G Sbjct: 133 G 133 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 654 G 656 G Sbjct: 87 G 87 >SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 55 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 114 Query: 654 G 656 G Sbjct: 115 G 115 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 100 Query: 654 G 656 G Sbjct: 101 G 101 >SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 654 G 656 G Sbjct: 89 G 89 >SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 126 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 185 Query: 654 G 656 G Sbjct: 186 G 186 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 654 G 656 G Sbjct: 85 G 85 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 90 Query: 654 G 656 G Sbjct: 91 G 91 >SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) Length = 163 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 120 Query: 654 G 656 G Sbjct: 121 G 121 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 191 Query: 654 G 656 G Sbjct: 192 G 192 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 654 G 656 G Sbjct: 107 G 107 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 152 Query: 654 G 656 G Sbjct: 153 G 153 >SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) Length = 261 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 159 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 218 Query: 654 G 656 G Sbjct: 219 G 219 >SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) Length = 248 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 147 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 206 Query: 654 G 656 G Sbjct: 207 G 207 >SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) Length = 136 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 654 G 656 G Sbjct: 95 G 95 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 67 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 126 Query: 654 G 656 G Sbjct: 127 G 127 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 112 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 171 Query: 654 G 656 G Sbjct: 172 G 172 >SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 654 G 656 G Sbjct: 86 G 86 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 249 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 308 Query: 654 G 656 G Sbjct: 309 G 309 Score = 81.4 bits (192), Expect = 9e-16 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = +3 Query: 510 AVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*NG 656 AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS NG Sbjct: 370 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 418 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 80 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 139 Query: 654 G 656 G Sbjct: 140 G 140 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 654 G 656 G Sbjct: 95 G 95 >SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 37 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 96 Query: 654 G 656 G Sbjct: 97 G 97 >SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 654 G 656 G Sbjct: 99 G 99 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 117 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 176 Query: 654 G 656 G Sbjct: 177 G 177 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 122 Query: 654 G 656 G Sbjct: 123 G 123 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 654 G 656 G Sbjct: 98 G 98 >SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 30 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 89 Query: 654 G 656 G Sbjct: 90 G 90 >SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 654 G 656 G Sbjct: 92 G 92 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 654 G 656 G Sbjct: 114 G 114 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 122 Query: 654 G 656 G Sbjct: 123 G 123 >SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 85 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 144 Query: 654 G 656 G Sbjct: 145 G 145 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 143 Query: 654 G 656 G Sbjct: 144 G 144 >SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 40 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 99 Query: 654 G 656 G Sbjct: 100 G 100 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 654 G 656 G Sbjct: 92 G 92 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 121 Query: 654 G 656 G Sbjct: 122 G 122 >SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 48 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 107 Query: 654 G 656 G Sbjct: 108 G 108 >SB_16189| Best HMM Match : rve (HMM E-Value=0.3) Length = 595 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 493 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 552 Query: 654 G 656 G Sbjct: 553 G 553 >SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 654 G 656 G Sbjct: 107 G 107 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 654 G 656 G Sbjct: 87 G 87 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 118 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 177 Query: 654 G 656 G Sbjct: 178 G 178 >SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 654 G 656 G Sbjct: 103 G 103 >SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 77 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 136 Query: 654 G 656 G Sbjct: 137 G 137 >SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 654 G 656 G Sbjct: 107 G 107 >SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 26 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 654 G 656 G Sbjct: 86 G 86 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 654 G 656 G Sbjct: 98 G 98 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 101 Query: 654 G 656 G Sbjct: 102 G 102 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 75 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 134 Query: 654 G 656 G Sbjct: 135 G 135 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 152 Query: 654 G 656 G Sbjct: 153 G 153 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 76 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 135 Query: 654 G 656 G Sbjct: 136 G 136 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 76 QFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 135 Query: 654 G 656 G Sbjct: 136 G 136 >SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) Length = 160 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 474 QFAL**VVLQFTAVVLQRRDWENXGVTQLNRLAAHPPFASWVIAKRPAPDXPSQQLRS*N 653 QFAL AVVLQRRDWEN GVTQLNRLAAHPPFASW ++ D PSQQLRS N Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 117 Query: 654 G 656 G Sbjct: 118 G 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,756,122 Number of Sequences: 59808 Number of extensions: 480904 Number of successful extensions: 8660 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5154 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -