BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0543.Seq (869 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75714-1|CAB00058.1| 194|Caenorhabditis elegans Hypothetical pr... 107 8e-24 >Z75714-1|CAB00058.1| 194|Caenorhabditis elegans Hypothetical protein ZC434.2 protein. Length = 194 Score = 107 bits (258), Expect = 8e-24 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 1/85 (1%) Frame = +3 Query: 3 VPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVA-NKQKRPRSRTL 179 VP+P+LKAF KI LVRELEKKF G+ ++ + R+ILPKP ++ KQKRPRSRTL Sbjct: 63 VPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSRTL 122 Query: 180 TSVYNAILEDLVFPAEIVGKRIRVK 254 T+V++A L++LV+PAE+VG+RIRVK Sbjct: 123 TAVHDAWLDELVYPAEVVGRRIRVK 147 Score = 69.3 bits (162), Expect = 3e-12 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = +2 Query: 251 QVDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFPEP 388 ++DG ++ KVHLDK+ QT + HK+ F SVY+KLTG++VTFEFP+P Sbjct: 147 KLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKLTGKDVTFEFPDP 192 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,074,116 Number of Sequences: 27780 Number of extensions: 352539 Number of successful extensions: 764 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2181923744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -