BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0542.Seq (953 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0191 + 18927302-18927707,18928747-18928979,18929062-189291... 30 3.1 01_06_1128 - 34724469-34724699,34726103-34726213,34726301-347264... 30 3.1 07_03_1733 + 29117547-29118203 29 4.1 08_01_0200 + 1632883-1633913,1634620-1634677 29 7.2 10_08_0973 - 21963754-21963936,21964089-21964383,21964504-219646... 28 9.5 05_01_0304 - 2392526-2392828 28 9.5 >05_04_0191 + 18927302-18927707,18928747-18928979,18929062-18929127, 18929262-18929340,18929935-18930014,18930099-18930122, 18930254-18930375,18930902-18931109,18931960-18932006, 18932914-18932998,18933292-18933355,18933488-18933609 Length = 511 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/75 (26%), Positives = 34/75 (45%) Frame = +1 Query: 490 DGMSAFIDQNQSTEGLASEVVNFDESG*LLQIAWSSTGDASFKCLALSTFDGSFCDYHGL 669 +G + + N+S E L+ + V F E + + GD F +L F + CDY G Sbjct: 189 EGFVSEMKLNKSEETLSRKFVAFQEPSEIACYSRIEGGDVYFDDRSLRLFKRNICDYVGE 248 Query: 670 SRVTGNQVRFRRRNL 714 + G + +R+L Sbjct: 249 NLNKGFESFIEKRDL 263 >01_06_1128 - 34724469-34724699,34726103-34726213,34726301-34726409, 34726517-34726581,34726661-34726838,34726918-34726997, 34727838-34727961,34728064-34728172,34728299-34728461 Length = 389 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 412 FLRSYSVTWITVVILELIHAIRTLTSDGMSAFIDQNQSTE 531 F+R Y TW + +L+ + TLT S F D ++T+ Sbjct: 241 FIRCYDCTWTLIDEYDLVDPVHTLTPPEESGFCDGVKATK 280 >07_03_1733 + 29117547-29118203 Length = 218 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +2 Query: 176 TTVHAKPFSTSVLQGLAGVFATTTKISPTEAPSGL 280 T V A P S+ G AG+ TTT +P +A SGL Sbjct: 141 TGVQADP--ASLADGAAGILPTTTTTAPFDASSGL 173 >08_01_0200 + 1632883-1633913,1634620-1634677 Length = 362 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 217 GPRWSICYYHQDLTDGGSKRAHAQTLLRSPSRTSS 321 G W IC+Y + GG R H LR +R ++ Sbjct: 36 GYDWCICFYPEGQGGGGGDREHVSVKLRLVTRCAT 70 >10_08_0973 - 21963754-21963936,21964089-21964383,21964504-21964616, 21964729-21964913,21965054-21965201,21965297-21965575, 21965657-21965761,21965936-21966178,21966426-21966486, 21966734-21966792 Length = 556 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +1 Query: 253 LTDGGSKRAHAQTLLRSPSRTSSYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLRSYS 429 L DGGS + A+ +PS +S+ +V+K P S N S+ FW+ ++S Sbjct: 183 LQDGGSSASTAECTSLAPSTSSASRVVNKKPPRRSLNVSGPVQPYNPSLKNFWYPVAFS 241 >05_01_0304 - 2392526-2392828 Length = 100 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 170 RATTVHAKPFSTSVLQGLAGVFATTTKISPTEAPS 274 RATTV A+P +T+V G AG ++ P AP+ Sbjct: 40 RATTVKARPATTAVAAGFAG---SSNSRQPAPAPA 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,008,733 Number of Sequences: 37544 Number of extensions: 498981 Number of successful extensions: 1145 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1145 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2752963900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -