BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0542.Seq (953 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 63 3e-10 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 62 5e-10 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 62 5e-10 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 62 5e-10 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 62 5e-10 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 62 5e-10 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 62 5e-10 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 62 5e-10 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 62 6e-10 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 62 8e-10 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 62 8e-10 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 62 8e-10 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 59 5e-09 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 54 2e-07 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 40 0.002 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) 38 0.009 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 37 0.028 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.084 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 34 0.19 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 34 0.19 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.79 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.79 SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 63.3 bits (147), Expect = 3e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 73 VKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 115 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 63.3 bits (147), Expect = 3e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 184 VKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 226 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 63.3 bits (147), Expect = 3e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 92 VKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 134 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 27 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 69 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 30 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 72 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 6 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 48 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 30 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 72 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 27 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 69 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 6 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 48 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 29 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 71 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 140 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 182 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 66 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 108 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 145 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 187 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 62.5 bits (145), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 6 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 48 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 62.1 bits (144), Expect = 6e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 18 RAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 RAGD LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 85 RAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 123 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 145 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 187 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 30 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 72 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 92 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 134 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 6 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 48 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 30 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 72 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 140 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 182 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 6 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 48 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 27 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 69 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 109 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 151 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 61.7 bits (143), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 92 VKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRY 134 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 1e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD LQL +NEEFLVSA+H+LALITSLPFVHT R+ Sbjct: 49 VKHRRAGDRSLQLLILNEEFLVSANHQLALITSLPFVHTARRY 91 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 60.1 bits (139), Expect = 3e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHT 122 +K RAGD LQL +NEEFLVSASH+LALITSLPFVHT Sbjct: 92 VKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHT 130 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 59.3 bits (137), Expect = 5e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RA D LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 92 VKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 134 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 59.3 bits (137), Expect = 5e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RA D LQL +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 143 VKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRY 185 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD +L NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 29 VKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFVHTARRY 71 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 6 LKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 +K RAGD +L NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 26 VKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFVHTARRY 68 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 36 LQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTARRY 62 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 36 LQLSPINEEFLVSASHKLALITSLPFVHTPHRH 134 LQL NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTARRY 62 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 51 INEEFLVSASHKLALITSLPFVHTPHRH 134 +NEEFLVSASH+LALITSLPFVHT R+ Sbjct: 7 LNEEFLVSASHQLALITSLPFVHTARRY 34 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 40 VSASHQLALITSLPFVHTARRY 61 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 15 VSASHQLALITSLPFVHTARRY 36 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 92 VSASHQLALITSLPFVHTARRY 113 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 69 VSASHKLALITSLPFVHTPHRH 134 VSASH+LALITSLPFVHT R+ Sbjct: 14 VSASHQLALITSLPFVHTARRY 35 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = +2 Query: 176 TTVHAKPFSTSVLQGLAGVFATTTKI 253 T VH +PFSTSV + L +FATTTKI Sbjct: 113 TAVHMEPFSTSVFKALIRIFATTTKI 138 >SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) Length = 164 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +2 Query: 176 TTVHAKPFSTSVLQGLAGVFATTTKISP 259 T VH PFSTS Q L +FATTTKI P Sbjct: 48 TAVHMDPFSTSGFQALILIFATTTKICP 75 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = +2 Query: 317 VVICLSQRLSHACLSASRIKAIPRMA 394 VVICLSQRLSHACLS S RMA Sbjct: 136 VVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = +2 Query: 317 VVICLSQRLSHACLSASRIKAIPRMA 394 VVICLSQRLSHACLS S RMA Sbjct: 112 VVICLSQRLSHACLSISTRTVKLRMA 137 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 36.7 bits (81), Expect = 0.028 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = -3 Query: 153 KLKERSYVDVACVQRAGT*STRAYDSRLLGIPRLWGIIANPNPQHEGVS 7 + K + +AC+Q + + A DSRLLGIPR IIA PQH+ VS Sbjct: 64 RCKTTASAKLACLQ-VDSRGSPADDSRLLGIPRSRSIIAMIYPQHDDVS 111 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = +3 Query: 156 DRLTREQLLFTRNPSPRQSSRASLEY 233 DRLT QLLFT N SP +SS+ S EY Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEY 114 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -3 Query: 129 DVACVQRAGT*STRAYDSRLLGIPR 55 D CVQRAGT S D RLLGIPR Sbjct: 43 DGRCVQRAGTQSMHIDDMRLLGIPR 67 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 72 DLGGSSKYSNESFEDRSGERF 92 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 71 DLGGSSKYSNESFEDRSGERF 91 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 71 DLGGSSKYSNESFEDRSGERF 91 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 71 DLGGSSKYSNESFEDRSGERF 91 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 150 DLGGSSKYSNESFEDRSGERF 170 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 98 DLGGSSKYSNESFEDRSGERF 118 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 65 DLGGSSKYSNESFEDRSGERF 85 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 98 DLGGSSKYSNESFEDRSGERF 118 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 253 DLGGSSKYSSEALED*RGEGF 191 DLGGSSKYS+E+ ED GE F Sbjct: 71 DLGGSSKYSNESFEDRSGERF 91 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 321 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 455 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 321 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 455 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 117 VQRAGT*STRAYDSRLLGIPRLW---GIIANPNPQHEGVS 7 VQ G TR+Y S L +W G+ NP+PQ +G S Sbjct: 535 VQTVGKAPTRSYHSCTLYRGEMWVIGGVYPNPDPQPDGCS 574 >SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 255 EILVVVANTPARPWRTDVEKG 193 +ILVVVAN R +T+VEKG Sbjct: 42 QILVVVANIQMRALKTEVEKG 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,910,007 Number of Sequences: 59808 Number of extensions: 534339 Number of successful extensions: 2176 Number of sequences better than 10.0: 107 Number of HSP's better than 10.0 without gapping: 2085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2176 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2800542235 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -