BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0542.Seq (953 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM183993-1|CAJ75481.1| 229|Homo sapiens immunoglobulin heavy ch... 31 6.2 >AM183993-1|CAJ75481.1| 229|Homo sapiens immunoglobulin heavy chain protein. Length = 229 Score = 31.1 bits (67), Expect = 6.2 Identities = 33/122 (27%), Positives = 50/122 (40%), Gaps = 3/122 (2%) Frame = +1 Query: 142 LLELRID*LASNYCSRETLLHVSPPGPRWSICYYH--QDLTDGGSKRAHAQTLLRSPSRT 315 L L+ D A YC+RE +LH G S+ YYH DL G+ + + PS Sbjct: 78 LSRLKSDDTAVYYCAREPVLH----GYYRSVRYYHYGMDLWGQGTTVTVSLASTKGPS-- 131 Query: 316 SSYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAI-RTLTSD 492 V + PC G A G + + +F +V+W + + +H L S Sbjct: 132 -----VFPLAPCSRSTSG--GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS 184 Query: 493 GM 498 G+ Sbjct: 185 GL 186 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,060,563 Number of Sequences: 237096 Number of extensions: 2662338 Number of successful extensions: 5302 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5302 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12603135794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -