BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0541.Seq (928 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0123 + 17475020-17475243,17475367-17475445,17476295-174763... 30 3.0 01_07_0083 + 40970890-40971015,40971886-40971994,40972679-409727... 29 4.0 04_04_0630 - 26719136-26719150,26720065-26720134,26720438-26721912 29 5.2 06_03_0378 + 20070955-20071354,20071483-20072132 29 6.9 >03_04_0123 + 17475020-17475243,17475367-17475445,17476295-17476393, 17476499-17476682,17477139-17477206,17477530-17477787, 17477996-17478049,17478149-17478355,17478507-17478633, 17479409-17479575 Length = 488 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 699 FNKNLTRILPNI-NAYNXPIAIPGAQLLGR 613 + KN + +PN+ NA P+ + G QLLGR Sbjct: 198 YPKNTSTFVPNVVNAQGNPMQVSGGQLLGR 227 >01_07_0083 + 40970890-40971015,40971886-40971994,40972679-40972790, 40972944-40973100,40973609-40973761,40974143-40974292, 40974803-40974999,40975446-40975473 Length = 343 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 145 NVYILHFYYLHC**KQVSNLCFYFM 71 NVY ++ Y +HC Q N+CF+F+ Sbjct: 90 NVYAIYSYTIHC-STQAENICFWFI 113 >04_04_0630 - 26719136-26719150,26720065-26720134,26720438-26721912 Length = 519 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +2 Query: 527 TLALPNL-IALQHIPLS-PAGVIAKRPAPIALPNSCAPGMAMGXL*ALIFGKIRVKFLLK 700 ++A+ N A H L+ P GV P++LP AP ++ L+ R L++ Sbjct: 215 SMAVENFTFACAHTALAEPVGVAGFGRGPLSLPAQLAPSLSGRFSYCLVAHSFRADRLIR 274 Query: 701 SSPFL 715 SSP + Sbjct: 275 SSPLI 279 >06_03_0378 + 20070955-20071354,20071483-20072132 Length = 349 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 500 VVLNVVTGKTLALPNLIALQHIPL 571 ++LN +TG+ +ALP +QH+ L Sbjct: 101 ILLNPITGRRIALPPATTMQHVTL 124 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,925,995 Number of Sequences: 37544 Number of extensions: 485543 Number of successful extensions: 1070 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1047 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2647531240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -