BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0541.Seq (928 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 3e-27 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 112 4e-25 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 112 4e-25 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 112 4e-25 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 104 1e-22 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 99 4e-21 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 99 6e-21 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 99 6e-21 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 99 6e-21 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 99 6e-21 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 99 6e-21 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 99 6e-21 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 99 6e-21 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 99 6e-21 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 99 6e-21 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 99 6e-21 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 99 6e-21 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 99 6e-21 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 99 6e-21 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 99 6e-21 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 99 6e-21 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 99 6e-21 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 99 6e-21 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 99 6e-21 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 99 6e-21 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 99 6e-21 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 99 6e-21 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 99 6e-21 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 99 6e-21 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 99 6e-21 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 99 6e-21 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 99 6e-21 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 99 6e-21 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 99 6e-21 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 99 6e-21 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 99 6e-21 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 99 6e-21 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 99 6e-21 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 99 6e-21 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 99 6e-21 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 99 6e-21 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 99 6e-21 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 99 6e-21 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 99 6e-21 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 99 6e-21 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 99 6e-21 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 99 6e-21 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 99 6e-21 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 99 6e-21 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 99 6e-21 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 99 6e-21 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 99 6e-21 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 8e-21 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 98 1e-20 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 98 1e-20 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 98 1e-20 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 98 1e-20 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 98 1e-20 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 98 1e-20 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 98 1e-20 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 98 1e-20 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 98 1e-20 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 98 1e-20 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 98 1e-20 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 98 1e-20 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 98 1e-20 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 98 1e-20 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 98 1e-20 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 98 1e-20 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 98 1e-20 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 98 1e-20 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 98 1e-20 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 98 1e-20 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 98 1e-20 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 98 1e-20 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 98 1e-20 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 98 1e-20 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 98 1e-20 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 98 1e-20 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 98 1e-20 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 98 1e-20 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 98 1e-20 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 98 1e-20 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 98 1e-20 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 98 1e-20 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 98 1e-20 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 98 1e-20 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 98 1e-20 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 98 1e-20 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 98 1e-20 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 98 1e-20 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 98 1e-20 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 98 1e-20 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 98 1e-20 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 98 1e-20 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 98 1e-20 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 98 1e-20 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 98 1e-20 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 98 1e-20 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 98 1e-20 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 98 1e-20 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 98 1e-20 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 98 1e-20 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 98 1e-20 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 98 1e-20 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 98 1e-20 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 98 1e-20 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 98 1e-20 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 98 1e-20 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 98 1e-20 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 98 1e-20 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 98 1e-20 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 119 bits (287), Expect = 3e-27 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -3 Query: 635 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPVNCNTTHYRANW 459 Q+RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF +KRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 112 bits (269), Expect = 4e-25 Identities = 51/62 (82%), Positives = 54/62 (87%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPVNCNTTHYRA 465 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSW GF +KRRPVNCNTTHYRA Sbjct: 590 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRA 646 Query: 464 NW 459 NW Sbjct: 647 NW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 112 bits (269), Expect = 4e-25 Identities = 51/62 (82%), Positives = 54/62 (87%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPVNCNTTHYRA 465 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSW GF +KRRPVNCNTTHYRA Sbjct: 33 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRA 89 Query: 464 NW 459 NW Sbjct: 90 NW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 112 bits (269), Expect = 4e-25 Identities = 51/62 (82%), Positives = 54/62 (87%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPVNCNTTHYRA 465 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSW GF +KRRPVNCNTTHYRA Sbjct: 33 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRA 89 Query: 464 NW 459 NW Sbjct: 90 NW 91 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 107 bits (258), Expect = 1e-23 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +1 Query: 493 TGRRFKRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 TGRRF RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 90 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 106 bits (254), Expect = 3e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 493 TGRRFKRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 TGRR +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 65 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 106 bits (254), Expect = 3e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 493 TGRRFKRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 TGRR +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 85 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 106 bits (254), Expect = 3e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 493 TGRRFKRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 TGRR +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 75 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 106 bits (254), Expect = 3e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 493 TGRRFKRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 TGRR +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 95 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 106 bits (254), Expect = 3e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 493 TGRRFKRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 TGRR +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 122 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 104 bits (249), Expect = 1e-22 Identities = 49/55 (89%), Positives = 50/55 (90%) Frame = -2 Query: 657 YNXPIAIPGAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 493 + P AI AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS Sbjct: 8 HQAPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 99 bits (238), Expect = 3e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 632 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPV 492 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 99 bits (238), Expect = 3e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 632 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPV 492 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 99 bits (238), Expect = 3e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 632 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPV 492 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 99 bits (238), Expect = 3e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 632 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPV 492 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 99 bits (238), Expect = 3e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 632 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPV 492 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 99 bits (238), Expect = 3e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 632 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPV 492 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 99 bits (238), Expect = 3e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 632 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLKRRPV 492 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 99.5 bits (237), Expect = 3e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT NG+ Sbjct: 35 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGE 80 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 99.5 bits (237), Expect = 3e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT NG+ Sbjct: 44 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGE 89 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 99.1 bits (236), Expect = 4e-21 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGDGXIVSVN 666 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ ++ N Sbjct: 1068 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 99.1 bits (236), Expect = 4e-21 Identities = 53/91 (58%), Positives = 58/91 (63%), Gaps = 1/91 (1%) Frame = +1 Query: 376 LTITALIKI-FLXXXXXXXXXXLEGGPGTQFAL**VVLQFTGRRFKRRDWENPGVTQLNR 552 +TIT +I I FL QFAL +RRDWENPGVTQLNR Sbjct: 94 ITITVIITIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNR 153 Query: 553 LAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 LAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 154 LAAHPPFASWRNSEEARTDRPSQQLRSLNGE 184 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 473 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 519 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 217 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 263 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 66 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 112 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 647 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 693 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 372 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 418 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 288 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 334 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 556 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 602 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 180 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 226 Score = 94.7 bits (225), Expect = 9e-20 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWEN GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 520 QRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 565 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 90 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 135 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 28 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 74 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 33 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 79 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 12 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 262 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 308 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 189 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 235 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 446 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 492 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 281 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 327 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 131 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 177 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 915 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 961 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 582 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 628 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 263 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 309 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 496 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 542 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 180 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 226 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 Score = 75.4 bits (177), Expect = 6e-14 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 649 AHRHSRCATVGKGDRCGPLRYYASWRKGDVLQGD 548 A RHS CATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 85 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 69 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 115 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 644 SPFQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRLK 504 SPF++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR K Sbjct: 20 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 98.3 bits (234), Expect = 8e-21 Identities = 54/93 (58%), Positives = 58/93 (62%) Frame = +1 Query: 367 CQDLTITALIKIFLXXXXXXXXXXLEGGPGTQFAL**VVLQFTGRRFKRRDWENPGVTQL 546 C LT T LI+ FL QFAL +RRDWENPGVTQL Sbjct: 17 CPFLTGTRLIE-FLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQL 75 Query: 547 NRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 NRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 76 NRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 108 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 40 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 85 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 67 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 112 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 49 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 94 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 41 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 67 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 112 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 72 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 117 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 43 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 88 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 63 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 108 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 75 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 120 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 51 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 96 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 40 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 85 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 30 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 75 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 55 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 100 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 64 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 109 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 58 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 103 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 74 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 119 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 62 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 107 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 45 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 90 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 221 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 266 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 116 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 161 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 54 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 99 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 33 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 78 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 21 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 66 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 52 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 97 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 386 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 431 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 112 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 157 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 88 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 133 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 44 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 13 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 58 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 23 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 68 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 43 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 88 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 108 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 153 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 50 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 95 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 345 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 390 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 85 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 130 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 55 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 100 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 21 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 66 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 64 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 109 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 48 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 93 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 139 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 184 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 68 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 113 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 44 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 148 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 193 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 838 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 883 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 21 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 66 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 65 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 110 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 39 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 78 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 123 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 61 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 106 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 74 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 119 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 261 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 306 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 119 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 164 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 55 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 100 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 41 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 42 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 87 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 106 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 151 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 119 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 164 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 44 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 25 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 70 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 63 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 108 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 42 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 87 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 39 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 16 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 61 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 24 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 69 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 401 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 446 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 50 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 95 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 59 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 104 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 41 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 124 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 169 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 60 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 105 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 70 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 115 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 73 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 118 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 419 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 464 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 116 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 161 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 72 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 117 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 61 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 106 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 51 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 96 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 166 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 211 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 70 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 115 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 57 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 102 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 93 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 138 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 42 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 87 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 68 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 113 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 47 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 92 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 190 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 235 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 39 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 45 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 90 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 59 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 104 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 56 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 101 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 39 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 40 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 85 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 54 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 99 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 44 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 137 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 182 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 46 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 91 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 89 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 134 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 27 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 72 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 158 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 203 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 345 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 390 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 62 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 107 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 26 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 71 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 52 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 97 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 114 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 159 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 34 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 91 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 136 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 41 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 65 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 110 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 299 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 344 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 62 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 107 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 63 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 108 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 21 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 66 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 41 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 416 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 461 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 100 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 145 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 97.9 bits (233), Expect = 1e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 508 KRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTWNGD 645 +RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ NG+ Sbjct: 56 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,325,953 Number of Sequences: 59808 Number of extensions: 550123 Number of successful extensions: 5118 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5072 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2693287426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -