BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0537.Seq (947 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 26 1.9 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 25 3.3 AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskele... 24 5.8 AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskel... 24 5.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 7.7 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.8 bits (54), Expect = 1.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 752 GCPGGDXRHGPTGYEXLXSSKGLRXCQGE 838 G PG GP GYE KG+ GE Sbjct: 408 GRPGAPGPKGPRGYEGPQGPKGMDGFDGE 436 Score = 25.4 bits (53), Expect = 2.5 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 752 GCPGGDXRHGPTGYEXLXSSKGLRXCQGE 838 G PG D G G L +KG R +GE Sbjct: 547 GLPGRDGEKGEPGRPGLPGAKGERGLKGE 575 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 25.0 bits (52), Expect = 3.3 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -1 Query: 566 IGTRNYLALEGSSKRPSGRIPQDGRIRSCLDIKLHHALHEAKDRSRSRTIVQK 408 IG + L L+ + + P G++ +RSCL I+ + L + R++V K Sbjct: 20 IGLSDALNLQDACETPDGKVGTCVYLRSCLSIR-NVLLKKENMTPEDRSLVMK 71 >AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 24.2 bits (50), Expect = 5.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 311 NLRRCMNWQYGPSPPC 358 NL C +W + P+ PC Sbjct: 117 NLTTCPSWAHAPNGPC 132 >AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 24.2 bits (50), Expect = 5.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 311 NLRRCMNWQYGPSPPC 358 NL C +W + P+ PC Sbjct: 117 NLTTCPSWAHAPNGPC 132 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 7.7 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 44 KTKHFHRRDRINLFNINCHTLMKCILGV 127 K K+FH + + L + HT K I G+ Sbjct: 2281 KAKYFHGLEELKLAPLTYHTFHKEIKGI 2308 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 900,131 Number of Sequences: 2352 Number of extensions: 17331 Number of successful extensions: 40 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 103776201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -