BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0537.Seq (947 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17270.1 68418.m02023 tetratricopeptide repeat (TPR)-containi... 29 4.5 At3g02330.1 68416.m00216 pentatricopeptide (PPR) repeat-containi... 28 7.9 >At5g17270.1 68418.m02023 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 899 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 Query: 204 DIISTERILTTLEKKNTNFKSSS 136 D++ +RI+T LEK+N+ KSSS Sbjct: 712 DVVLLDRIMTELEKRNSACKSSS 734 >At3g02330.1 68416.m00216 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 861 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/46 (23%), Positives = 25/46 (54%) Frame = -3 Query: 210 LFDIISTERILTTLEKKNTNFKSSSYFLTPRIHFIKVWQFILNKFI 73 L D++S +++ K N FK++S+F + + W +L+ ++ Sbjct: 69 LRDVVSWNKMINGYSKSNDMFKANSFFNMMPVRDVVSWNSMLSGYL 114 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,570,372 Number of Sequences: 28952 Number of extensions: 360582 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2275754832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -