BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0536.Seq (881 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 26 8.2 SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|... 26 8.2 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 25.8 bits (54), Expect = 8.2 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +3 Query: 261 EHLFNTANILRTFVRNSTKSIDHTGNASLSSFV 359 +H ++ A +R+ ++ + TGN++L+SFV Sbjct: 1172 KHAYDQAKEVRSLTYSTITELVRTGNSTLTSFV 1204 >SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 461 Score = 25.8 bits (54), Expect = 8.2 Identities = 25/83 (30%), Positives = 33/83 (39%) Frame = -3 Query: 591 QDRYFSFSQLAXCANTTTFSGMVTCSIKCNPCSRAE*MVCSETSPANTYSLNVIPVVKVM 412 Q RY S +A N F V S CN S ++ + +P+ S + PV V Sbjct: 129 QQRYMPDSAVAYNPNQDQFGNSVNVSAACNNVSAP--LIANNCAPSFYQSRH--PVADV- 183 Query: 411 PG*NECITNYSCTSTTQPRRMIM 343 P N T S T T P + M Sbjct: 184 PVTNNTATTTSETDNTIPGNLNM 206 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,433,673 Number of Sequences: 5004 Number of extensions: 67022 Number of successful extensions: 147 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 442483990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -