BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0536.Seq (881 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 2.3 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 25 4.0 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 25 4.0 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 25 4.0 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 25 4.0 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 25 4.0 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 25 4.0 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 25 4.0 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 25 4.0 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 25 4.0 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 25 4.0 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 25 4.0 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 25 4.0 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 25 4.0 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 25 4.0 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 25 4.0 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 25 4.0 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 25 4.0 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 25 4.0 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 4.0 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 5.3 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 9.3 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 9.3 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 9.3 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.4 bits (53), Expect = 2.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 373 IHYTATKDDNEALPV*SIDFVEFRTKVRRIFAVLNKC 263 ++Y T+DD+E P +EF K+ IF V + C Sbjct: 755 VYYFPTEDDDEDGPTFKDKALEFLMKMIDIFCVWDCC 791 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 128 GVHSLPCVIMVLNDHNYVYKDSV 150 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 128 GVHSLPCVIMVLNDHNYVYKDSV 150 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 130 GVHSLPCVIMVLNDHNYVYKDSV 152 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 130 GVHSLPCVIMVLNDHNYVYKDSV 152 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 133 GVHSLPCVIMVLNDHNYVYKDSV 155 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 133 GVHSLPCVIMVLNDHNYVYKDSV 155 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 143 GVHSLPCVIMVLNDHNYVYKDSV 165 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 145 GVHSLPCVIMVLNDHNYVYKDSV 167 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 145 GVHSLPCVIMVLNDHNYVYKDSV 167 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 127 GVHSLPCVIMVLNDHNYVYKDSV 149 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 127 GVHSLPCVIMVLNDHNYVYKDSV 149 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 370 GCTAIVCYALILSRHNLYYRDNV 438 G ++ C ++L+ HN Y+D+V Sbjct: 142 GVHSLPCVIMVLNDHNYVYKDSV 164 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.6 bits (51), Expect = 4.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 703 WKLGTAGDXXAKPENGXWEL 762 WK A + + ENG WEL Sbjct: 719 WKTAMAEEMQSHQENGTWEL 738 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.2 bits (50), Expect = 5.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 12 LHISLREDLDKGTPTVISRPES 77 LHI L ED+ + TP +I + ES Sbjct: 248 LHIKLDEDVVQQTPHIIQQCES 269 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.4 bits (48), Expect = 9.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 257 NRQKLIHRINVTSLR 213 NRQ+LIH+ + SLR Sbjct: 402 NRQRLIHKAKMKSLR 416 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.4 bits (48), Expect = 9.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 257 NRQKLIHRINVTSLR 213 NRQ+LIH+ + SLR Sbjct: 403 NRQRLIHKAKMKSLR 417 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.4 bits (48), Expect = 9.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 79 SLSGRLITVGVPLSRSSRKEMC 14 S SG + +G P+S S+RK+ C Sbjct: 801 SNSGFIFHLGGPISWSARKQQC 822 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 882,412 Number of Sequences: 2352 Number of extensions: 17751 Number of successful extensions: 84 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -