BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0536.Seq (881 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC024919-1|AAH24919.1| 289|Homo sapiens nucleotide binding prot... 39 0.028 AK022722-1|BAB14203.1| 289|Homo sapiens protein ( Homo sapiens ... 39 0.028 >BC024919-1|AAH24919.1| 289|Homo sapiens nucleotide binding protein-like protein. Length = 289 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +3 Query: 6 MPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRVAAQL 128 +PLH+++RE D G P V S+PES+ Y ++A V +L Sbjct: 244 IPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVRRL 284 >AK022722-1|BAB14203.1| 289|Homo sapiens protein ( Homo sapiens cDNA FLJ12660 fis, clone NT2RM4002174, moderately similar to MRP PROTEIN. ). Length = 289 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +3 Query: 6 MPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRVAAQL 128 +PLH+++RE D G P V S+PES+ Y ++A V +L Sbjct: 244 IPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVRRL 284 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,135,415 Number of Sequences: 237096 Number of extensions: 2565258 Number of successful extensions: 3444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3442 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11270645666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -