BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0534.Seq (958 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27D7.13c |ssm4|SPAC637.01c|p150-Glued|Schizosaccharomyces po... 26 9.0 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 26 9.0 >SPAC27D7.13c |ssm4|SPAC637.01c|p150-Glued|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 25.8 bits (54), Expect = 9.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 113 HSKGKHLHR*IPSKLAHARAFRSFCANTA 27 HSKG +L + S+L R C NTA Sbjct: 198 HSKGSYLKENLKSELRKGRLDELMCENTA 226 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 25.8 bits (54), Expect = 9.0 Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 3/68 (4%) Frame = -2 Query: 804 PYLGXILWIXKGICDSAYGXKKERI*QKFNANFNKILTLTICPFAHSXCATVGK---GDR 634 PYL LW+ GI DS G I + + + TL I A S + + + + Sbjct: 1257 PYLSRALWLWLGILDSIQGIGNGLILLQTLSRRHVTNTLMISQLAGSATSILARFVSPTK 1316 Query: 633 CGPLRYYP 610 GP +P Sbjct: 1317 TGPANVFP 1324 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,847,912 Number of Sequences: 5004 Number of extensions: 80466 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 489310570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -