BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0534.Seq (958 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC100785-1|AAI00786.1| 220|Homo sapiens LHFPL1 protein protein. 31 4.7 AY358208-1|AAQ88575.1| 243|Homo sapiens VTYC5824 protein. 31 4.7 AY217350-1|AAO60107.1| 220|Homo sapiens lipoma HMGIC fusion par... 31 4.7 >BC100785-1|AAI00786.1| 220|Homo sapiens LHFPL1 protein protein. Length = 220 Score = 31.5 bits (68), Expect = 4.7 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = -3 Query: 659 AQLLGRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YAHYRANW 489 ++++GR +GA F L GCA L W +P Q+ C +++ R W Sbjct: 113 SRMMGRCMGAAQFVGGLLISSGCALYPLGWNSPEIMQT--CGNVSNQFQLGTCRLGW 167 >AY358208-1|AAQ88575.1| 243|Homo sapiens VTYC5824 protein. Length = 243 Score = 31.5 bits (68), Expect = 4.7 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = -3 Query: 659 AQLLGRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YAHYRANW 489 ++++GR +GA F L GCA L W +P Q+ C +++ R W Sbjct: 136 SRMMGRCMGAAQFVGGLLISSGCALYPLGWNSPEIMQT--CGNVSNQFQLGTCRLGW 190 >AY217350-1|AAO60107.1| 220|Homo sapiens lipoma HMGIC fusion partner-like 1 protein. Length = 220 Score = 31.5 bits (68), Expect = 4.7 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = -3 Query: 659 AQLLGRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YAHYRANW 489 ++++GR +GA F L GCA L W +P Q+ C +++ R W Sbjct: 113 SRMMGRCMGAAQFVGGLLISSGCALYPLGWNSPEIMQT--CGNVSNQFQLGTCRLGW 167 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,774,116 Number of Sequences: 237096 Number of extensions: 3257597 Number of successful extensions: 9075 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9075 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12658656216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -