BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0530.Seq (939 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosac... 28 2.2 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 26 8.8 >SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosaccharomyces pombe|chr 3|||Manual Length = 1140 Score = 27.9 bits (59), Expect = 2.2 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 2/70 (2%) Frame = -2 Query: 737 GLLPALPNSATRGDHPPNLSILVSGGKKLTRISLVAASE--QEYSPSTESRCFNR*REMW 564 GL L A+ + PN+ LV GK RIS+ ++ + Y P + R + Sbjct: 136 GLTICLGAKASNTNRAPNMKSLVKQGKNYARISVTISNRGFEAYQPEIYGKSITIERTIR 195 Query: 563 CSGGSAFSSR 534 G S + R Sbjct: 196 REGSSEYRLR 205 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 25.8 bits (54), Expect = 8.8 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 481 WHPLRENGPVKTNLDRSRRDEKAEPPEHHISRYRLKQRDSVL 606 WHP N P+ T R+ + +H RYRL ++ V+ Sbjct: 432 WHPDCLNPPLATLPSNLRKWKCPNHSDHVTPRYRLPEKAKVI 473 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,488,469 Number of Sequences: 5004 Number of extensions: 70465 Number of successful extensions: 153 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 477327454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -