BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0525.Seq (614 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067608-12|AAC17651.1| 458|Caenorhabditis elegans Hypothetical... 29 2.6 Z70038-1|CAA93884.1| 2219|Caenorhabditis elegans Hypothetical pr... 27 8.1 >AF067608-12|AAC17651.1| 458|Caenorhabditis elegans Hypothetical protein B0511.2 protein. Length = 458 Score = 29.1 bits (62), Expect = 2.6 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = -3 Query: 582 VLHHFIFNNNFKSLQYLNILSLFKSITK*NHKMPRGKFTNHKG----RNRKFTSPEE--L 421 V H+F F+ N K +QY + +L TK + K N+K N+KF + E + Sbjct: 310 VFHNFFFDFNEKYIQYYVVAALEDFKTKFEIYANKKKLRNYKSDRSEGNQKFQAEEVKLM 369 Query: 420 EEQRKHDEQ 394 EE KH + Sbjct: 370 EEVGKHKSE 378 >Z70038-1|CAA93884.1| 2219|Caenorhabditis elegans Hypothetical protein ZK1067.2 protein. Length = 2219 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 477 GKFTNHKGRNRKFTSPEELEEQRKHDEQKKKWRKEQ 370 G + H R+ KF SP+ EE+RK+ E+ + +Q Sbjct: 427 GTVSEHS-RDDKFVSPQNCEEKRKYCEEDTDAKPQQ 461 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,280,965 Number of Sequences: 27780 Number of extensions: 117953 Number of successful extensions: 443 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -