BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0519.Seq (880 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 27 1.00 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 26 1.3 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 25 3.0 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 4.0 AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse t... 25 4.0 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 4.0 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 26.6 bits (56), Expect = 1.00 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 386 PGYDRRGPY-HR*IRLPRSGRQRTVH 460 PGYD+ GPY H I L R R T++ Sbjct: 211 PGYDKNGPYQHHDIALIRLDRDVTMN 236 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 26.2 bits (55), Expect = 1.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 399 VEAHTTDRFGCPDRVAREQ 455 VE H T CP+R+AR Q Sbjct: 379 VEPHITGSLRCPNRIARRQ 397 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 25.0 bits (52), Expect = 3.0 Identities = 25/100 (25%), Positives = 40/100 (40%), Gaps = 2/100 (2%) Frame = +3 Query: 222 GHRSHTAEKRCDGHFSGEFLEVQRQFFRPQNGHVRFRRRTHGVQGVQETEAVFGNQGTTV 401 G+ + TA+ HF G + + R R + G R R H + ++GN Sbjct: 193 GYGNFTADAFTCLHFQGSAMLLHRLLERYRPGRPRATRYVHVLNAEIVLHDLWGNVDYW- 251 Query: 402 EAHTTDRFGCP--DRVAREQFIVFRSTQEANHTQFHDQWS 515 EA + RF P D R + S+ A+ T +W+ Sbjct: 252 EARRSMRFAPPLVDVATRFRAEYLNSSDRADRTVRPARWT 291 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 822 AEFGKRRKPWNKXSVXPEEXLNXTALWV 739 A FG+ RK WN S+ + LW+ Sbjct: 280 AVFGRERKVWNSASLIDVDRDGKDELWL 307 >AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse transcriptase protein. Length = 134 Score = 24.6 bits (51), Expect = 4.0 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 49 LRTNLHFQFFVNAAVDCVQHGFRQVCTRTEELHLFTND 162 L + + F N + Q GFR + T +LH TN+ Sbjct: 19 LESRMALHTFNNNIIPKSQFGFRPSLSTTHQLHRVTNN 56 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 730 RKWLRNTATTSLVRLPTLRK 671 RKW+++T L+R P+L++ Sbjct: 573 RKWIKDTFEDKLIRQPSLQQ 592 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 997,863 Number of Sequences: 2352 Number of extensions: 23293 Number of successful extensions: 97 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -