BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0518.Seq (914 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 29 1.2 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 27 2.8 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 4.9 SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe... 26 6.5 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 8.6 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 8.6 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 26 8.6 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +2 Query: 65 CLINFRW*F---LRLPWLSRVTGNQGSIPEREPEKRLP 169 C+IN W LRL +L + NQ S E++ EKR+P Sbjct: 271 CMINETWPVDRALRLQFLIQQRNNQSSNEEQKQEKRVP 308 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 190 RANYPLPAREVVTKNNDT 243 +AN P+P EVVT+NN T Sbjct: 199 KANIPVPTSEVVTENNVT 216 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 4.9 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +3 Query: 312 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 476 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 477 SCA 485 S A Sbjct: 232 SDA 234 >SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 738 Score = 26.2 bits (55), Expect = 6.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 658 HY*RTWTPTSXGEKPSIXAMAHYVNHHPNQVFLGPV 765 HY R+ P G P A ++NHH Q+ PV Sbjct: 18 HYKRSSVPFPYG-LPDYDAEYQFINHHMQQLLTRPV 52 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.8 bits (54), Expect = 8.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 547 VKSAHFLTNRPKSAKSLINQKNRP 618 VK FLTN + SL+ Q NRP Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRP 698 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 8.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 178 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 80 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 25.8 bits (54), Expect = 8.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 494 PFXCATVGKGDRCGPLRYYASWRKGDV 414 P C V G R GP Y +W+ DV Sbjct: 392 PKVCLFVRNGARLGPTSIYHAWKAFDV 418 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,669,957 Number of Sequences: 5004 Number of extensions: 76871 Number of successful extensions: 144 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 464508080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -