BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0517.Seq (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 131 8e-31 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 117 1e-26 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 117 1e-26 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 117 1e-26 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 81 2e-15 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 79 4e-15 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 79 6e-15 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 79 6e-15 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 78 8e-15 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 78 1e-14 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 78 1e-14 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 78 1e-14 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 78 1e-14 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 78 1e-14 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 78 1e-14 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 78 1e-14 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 78 1e-14 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 78 1e-14 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 78 1e-14 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 78 1e-14 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 78 1e-14 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 78 1e-14 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 78 1e-14 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 78 1e-14 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 78 1e-14 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 78 1e-14 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 78 1e-14 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 78 1e-14 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 78 1e-14 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 78 1e-14 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 78 1e-14 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 78 1e-14 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 78 1e-14 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 78 1e-14 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 78 1e-14 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 78 1e-14 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 78 1e-14 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 78 1e-14 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 78 1e-14 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 78 1e-14 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 78 1e-14 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 78 1e-14 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 78 1e-14 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 78 1e-14 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 78 1e-14 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 78 1e-14 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 78 1e-14 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 77 1e-14 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 77 1e-14 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 77 1e-14 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 77 1e-14 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 77 1e-14 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 77 1e-14 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 77 1e-14 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 77 1e-14 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 77 1e-14 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 77 2e-14 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 77 2e-14 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 77 2e-14 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 77 2e-14 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 77 2e-14 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 77 2e-14 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 77 2e-14 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 77 2e-14 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 77 2e-14 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 77 2e-14 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 77 2e-14 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 77 2e-14 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 77 2e-14 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 77 2e-14 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 77 2e-14 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 77 2e-14 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 77 2e-14 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 77 2e-14 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 77 2e-14 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 77 2e-14 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 77 2e-14 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 77 2e-14 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 77 2e-14 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 77 2e-14 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 77 2e-14 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 77 2e-14 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 77 2e-14 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 77 2e-14 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 77 2e-14 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 77 2e-14 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 77 2e-14 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 77 2e-14 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 77 2e-14 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 77 2e-14 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 75 1e-13 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 75 1e-13 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 75 1e-13 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 75 1e-13 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 75 1e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 75 1e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 75 1e-13 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 75 1e-13 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 75 1e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 75 1e-13 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 75 1e-13 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 75 1e-13 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 75 1e-13 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 75 1e-13 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 75 1e-13 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 75 1e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 75 1e-13 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 75 1e-13 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 75 1e-13 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 131 bits (316), Expect = 8e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 443 Q+RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 117 bits (282), Expect = 1e-26 Identities = 55/67 (82%), Positives = 58/67 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNT 464 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNT Sbjct: 587 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNT 641 Query: 463 THYRANW 443 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 117 bits (282), Expect = 1e-26 Identities = 55/67 (82%), Positives = 58/67 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNT 464 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNT 84 Query: 463 THYRANW 443 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 117 bits (282), Expect = 1e-26 Identities = 55/67 (82%), Positives = 58/67 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNT 464 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNT 84 Query: 463 THYRANW 443 THYRANW Sbjct: 85 THYRANW 91 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 89.0 bits (211), Expect = 4e-18 Identities = 43/63 (68%), Positives = 47/63 (74%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKR 485 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSW GFPSHDVVKR Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKR 64 Query: 484 RPV 476 RPV Sbjct: 65 RPV 67 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 83.8 bits (198), Expect = 2e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV 476 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 83.8 bits (198), Expect = 2e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV 476 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 83.8 bits (198), Expect = 2e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV 476 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 83.8 bits (198), Expect = 2e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV 476 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 83.8 bits (198), Expect = 2e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV 476 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 83.8 bits (198), Expect = 2e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV 476 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 83.8 bits (198), Expect = 2e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV 476 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 83.4 bits (197), Expect = 2e-16 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = +3 Query: 477 TGRRFTTS*LGNPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 TGRRFT NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 86 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 80.6 bits (190), Expect = 2e-15 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 637 NLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +L ++I++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 499 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 79.8 bits (188), Expect = 3e-15 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 631 PFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 P+ ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 526 PYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 566 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 509 SQSRRCKTTASE 474 SQSRRCKTTASE Sbjct: 567 SQSRRCKTTASE 578 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 79.8 bits (188), Expect = 3e-15 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -2 Query: 679 NKNLTRILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 NKN R + + ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 201 NKNSKRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 257 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 258 SQSRRCKTTASEL 270 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 79.4 bits (187), Expect = 4e-15 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -2 Query: 661 ILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +L + Y+Y +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 343 VLWEIYSYGRQPYSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 393 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 394 SQSRRCKTTASEL 406 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.0 bits (186), Expect = 5e-15 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 631 PFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 P A ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 92 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 78.6 bits (185), Expect = 6e-15 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 477 TGRRFTTS*LGNPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 TGRR NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 61 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 78.6 bits (185), Expect = 6e-15 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 Q+RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 924 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 925 SQSRRCKTTASEL 937 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 78.6 bits (185), Expect = 6e-15 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 477 TGRRFTTS*LGNPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 TGRR NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 78.6 bits (185), Expect = 6e-15 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 477 TGRRFTTS*LGNPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 TGRR NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 71 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 78.6 bits (185), Expect = 6e-15 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 477 TGRRFTTS*LGNPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 TGRR NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 91 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 78.6 bits (185), Expect = 6e-15 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 477 TGRRFTTS*LGNPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 TGRR NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 118 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 78.6 bits (185), Expect = 6e-15 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 622 IQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 I++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 276 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 277 SQSRRCKTTASEL 289 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/44 (79%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = -2 Query: 634 LPFA--IQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +PF +++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 135 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 78.6 bits (185), Expect = 6e-15 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 Q+RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 164 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 200 Score = 74.5 bits (175), Expect = 1e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 510 NPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 60 NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 78.2 bits (184), Expect = 8e-15 Identities = 39/53 (73%), Positives = 42/53 (79%) Frame = -2 Query: 667 TRILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 T I K A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 361 TLIGFKQGASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 411 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 412 SQSRRCKTTASEL 424 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = -2 Query: 640 YNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 + PFAIQ WEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = -2 Query: 640 YNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 + PFAIQ WEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 461 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 512 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 54 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 105 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 635 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 686 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 544 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 595 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 77.8 bits (183), Expect = 1e-14 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -2 Query: 655 TKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +K A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 173 SKEGASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 71.3 bits (167), Expect = 9e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 510 NPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 N GVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 526 NTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 561 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 478 LAVVLQRRDWETLALPNLIALQHIP 552 LAVVLQRRDWE + L L P Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHP 539 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 77.8 bits (183), Expect = 1e-14 Identities = 45/72 (62%), Positives = 49/72 (68%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNT 464 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF RR C T Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKT 52 Query: 463 THYRANWVPGPP 428 T A+ PG P Sbjct: 53 T---ASEFPGDP 61 Score = 74.5 bits (175), Expect = 1e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 510 NPGVTQLNRLAAHPPFASWRNSEXARTXRPSQQLRT 617 NPGVTQLNRLAAHPPFASWRNSE ART RPSQQLR+ Sbjct: 96 NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 131 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 509 SQSRRCKTTASEL*YDSL 456 SQSRRCKTTASE D L Sbjct: 45 SQSRRCKTTASEFPGDPL 62 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 77.8 bits (183), Expect = 1e-14 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 622 IQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 90 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 177 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 228 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 77.8 bits (183), Expect = 1e-14 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 622 IQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 I +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 127 ITLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 164 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 903 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 954 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 251 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 302 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 60.1 bits (139), Expect = 2e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 615 CATVGKGXRXGPXRYYASWRKGDVLQGD 532 CATVGKG R GP RYYASWRKGDVLQGD Sbjct: 91 CATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 57 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 108 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = -2 Query: 664 RILTKYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 R + + Y ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 8 RCVRRKYRIRRHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = -2 Query: 652 KYYAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +Y A P + +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 358 RYRATGKP--VVLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 403 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 214 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 256 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 257 SQSRRCKTTASEL 269 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 285 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 327 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 328 SQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRP 479 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF K P Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTP 47 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 622 IQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 I +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 332 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 25 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 67 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 68 SQSRRCKTTASEL 80 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 30 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 72 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 259 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 301 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 302 SQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 443 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 485 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 486 SQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 278 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 320 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 321 SQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 128 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 170 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 171 SQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 625 AIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 444 AHRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 482 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 579 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 621 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 622 SQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 493 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 535 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 536 SQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -2 Query: 634 LPFAIQ-VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +P A+ +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 118 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 119 SQSRRCKTTASEL 131 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 643 AYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A + PF ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 177 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 220 SQSRRCKTTASEL 232 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -2 Query: 625 AIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 144 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 182 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 260 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 261 SQSRRCKTTASEL 273 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = -2 Query: 646 YAYNLPFAIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 + Y +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 397 FLYKRDLRQALRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 442 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -2 Query: 625 AIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 31 ARMLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 69 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -2 Query: 625 AIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 787 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 825 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -2 Query: 625 AIQVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 A +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 369 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 407 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 1105 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 1141 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 110 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 146 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 303 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 304 SQSRRCKTTASEL 316 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 486 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 522 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 251 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 287 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 288 SQSRRCKTTASEL 300 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 94 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 130 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 15 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 193 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 229 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 230 SQSRRCKTTASEL 242 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 426 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 427 SQSRRCKTTASEL 439 >SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 14 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 50 >SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 77.0 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 619 QVRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 ++RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 232 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 268 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 224 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 259 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 451 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 486 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 21 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 56 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 51 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 86 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 156 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 191 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 39 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 74 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 56 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 91 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 119 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 154 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 509 SQSRRCKTTASEL 471 SQSRRCKTTASEL Sbjct: 155 SQSRRCKTTASEL 167 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 616 VRNCWEGRXVRAXSLLRQLAKGGCAARRLSWVTPGF 509 +RNCWEGR VRA SLLRQLAKGGCAARRLSWVTPGF Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,803,758 Number of Sequences: 59808 Number of extensions: 397977 Number of successful extensions: 7887 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7857 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -