BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0517.Seq (869 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67738-2|CAA91546.2| 482|Caenorhabditis elegans Hypothetical pr... 30 2.5 AL031635-4|CAA21043.2| 269|Caenorhabditis elegans Hypothetical ... 29 4.3 >Z67738-2|CAA91546.2| 482|Caenorhabditis elegans Hypothetical protein W03G11.3 protein. Length = 482 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 191 PEFYVL*TVRECDSSQEILFGLIYFTTFATFHPLNLINGKQN 316 P+ ++ +R+ ++ FGL YF+ F FHP+ L +GK N Sbjct: 142 PKRDIVGELRDAFKKTDVHFGL-YFSQFEWFHPMFLDDGKFN 182 >AL031635-4|CAA21043.2| 269|Caenorhabditis elegans Hypothetical protein Y47D3B.6 protein. Length = 269 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 547 IPLSPAGVIAXRPXPXALPNS-CAP 618 IP++PA V+A R P ALP S C P Sbjct: 145 IPVAPAPVVAGRLIPQALPGSPCEP 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,752,794 Number of Sequences: 27780 Number of extensions: 300364 Number of successful extensions: 634 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2181923744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -