BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0516.Seq (976 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 25 1.0 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 24 2.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 5.5 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 22 7.3 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 25.0 bits (52), Expect = 1.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 718 CGASSISGXMIGDRKKFNALXFGLGNVI 635 CGA I G +GD K + GL +I Sbjct: 211 CGAGFIDGLGLGDNTKAAVMRLGLMEII 238 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 23.8 bits (49), Expect = 2.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -3 Query: 653 WPGQCNHLMCYMHVCWQRY 597 WP + L CYM+ W+++ Sbjct: 63 WP-ETRQLKCYMYCLWEQF 80 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 3.2 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -3 Query: 338 KNIQHCAFNFARYPAPRAGHLPQHEHHAQVEEI 240 + + HCA N P PR G H +EI Sbjct: 1690 EELNHCAPNRRCPPPPRMGSAEGLSHRGMEDEI 1722 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 5.5 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -2 Query: 525 DALLVAVARSTCPQPSPLFRAGQW---CEKCTP 436 D ++ + S P+PS G W C C+P Sbjct: 362 DGMIEVIPLSAIPEPSKNPAMGHWQMSCVACSP 394 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.2 bits (45), Expect = 7.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 494 VDRATATNKASGFLLSLGGN 553 VD ATA +K+ + SL GN Sbjct: 138 VDAATAGDKSCRYTASLAGN 157 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 262,358 Number of Sequences: 438 Number of extensions: 5848 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 32169774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -