BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0514.Seq (909 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 23 5.1 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 8.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 8.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 8.9 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 22.6 bits (46), Expect = 5.1 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +2 Query: 65 SLQRKRRLFQFVCLCDRINLLL*IS 139 +L+ K + +++ +C+R+NL L +S Sbjct: 22 ALENKFKTTRYLSVCERLNLALSLS 46 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.8 bits (44), Expect = 8.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 413 RTLYITFFFINIVTSTIIL 357 R L FF IV++T+IL Sbjct: 430 RALLCVFFLTTIVSTTVIL 448 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 8.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 11 LFIFLIFCVISYLGIFFCSLQRKRRLFQFV 100 LFI ++ C +SYL FC + +FQ + Sbjct: 417 LFIAIV-CFVSYLIGLFCITEGGMYVFQLL 445 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 8.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 11 LFIFLIFCVISYLGIFFCSLQRKRRLFQFV 100 LFI ++ C +SYL FC + +FQ + Sbjct: 470 LFIAIV-CFVSYLIGLFCITEGGMYVFQLL 498 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,346 Number of Sequences: 438 Number of extensions: 4051 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29509116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -