BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ps4M0514.Seq
(909 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At1g52940.1 68414.m05987 calcineurin-like phosphoesterase family... 31 1.4
>At1g52940.1 68414.m05987 calcineurin-like phosphoesterase family
protein contains Pfam profile: PF00149 calcineurin-like
phosphoesterase
Length = 396
Score = 30.7 bits (66), Expect = 1.4
Identities = 16/41 (39%), Positives = 23/41 (56%)
Frame = +1
Query: 391 KNVIYNVLSYSYIDLSTGGVFQAVIKTRLR*KYKCAFFYSL 513
K+VI SY Y D ++G + A+IK +YK +FY L
Sbjct: 59 KSVIATTSSYRYFDYTSGYLHHAIIKEL---EYKTKYFYEL 96
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,856,605
Number of Sequences: 28952
Number of extensions: 282478
Number of successful extensions: 383
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 382
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 383
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2149324008
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -