BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0514.Seq (909 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g52940.1 68414.m05987 calcineurin-like phosphoesterase family... 31 1.4 >At1g52940.1 68414.m05987 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 396 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 391 KNVIYNVLSYSYIDLSTGGVFQAVIKTRLR*KYKCAFFYSL 513 K+VI SY Y D ++G + A+IK +YK +FY L Sbjct: 59 KSVIATTSSYRYFDYTSGYLHHAIIKEL---EYKTKYFYEL 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,856,605 Number of Sequences: 28952 Number of extensions: 282478 Number of successful extensions: 383 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -