BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0509.Seq (928 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 29 1.2 SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c... 27 5.0 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 28.7 bits (61), Expect = 1.2 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = -1 Query: 400 KGLLALVKYYGTAISSYQSVAFSFATLAISSFHSLYRNNRTSQHLYLNLPNNSIRLHVVQ 221 KGLL L+ Y G ++ Y A FA ++ + N T L++ + +IR H Q Sbjct: 1191 KGLLYLILYLGNYMNDYVRQAKGFAIGSLQRLPLIKNANNTKS--LLHILDITIRKHFPQ 1248 Query: 220 F 218 F Sbjct: 1249 F 1249 >SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1717 Score = 26.6 bits (56), Expect = 5.0 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 222 NFAQIYGKYEGI*HESLLLY 163 N+ +Y +Y+GI H SLLL+ Sbjct: 83 NWEALYSQYDGILHASLLLF 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,628,296 Number of Sequences: 5004 Number of extensions: 72967 Number of successful extensions: 178 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 469338710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -