Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0509.Seq
         (928 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0229 + 1731288-1732513,1733037-1733106,1733267-1734001           31   0.98 

>12_01_0229 + 1731288-1732513,1733037-1733106,1733267-1734001
          Length = 676

 Score = 31.5 bits (68), Expect = 0.98
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = -2

Query: 789 ALSPK-VHFSISEKDNKCARAECRITNRCEYLHYDCVRRRP 670
           AL PK +H  + + DN CA A+C I    E++  D +RR P
Sbjct: 589 ALYPKFLHVGVGDDDNACAGAQCAIC-LGEFVAGDALRRGP 628


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,595,143
Number of Sequences: 37544
Number of extensions: 433797
Number of successful extensions: 828
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 809
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 828
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2647531240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)