BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0509.Seq (928 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12930| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 >SB_12930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 870 YKSQSASPWWPHMALSNVVPXTIGXHLALSP 778 Y ++ ASPWWP++ LS V+ + G + P Sbjct: 10 YSAKPASPWWPNVILSKVLSVSRGVTYSAKP 40 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 870 YKSQSASPWWPHMALSNVVPXTIGXHLALSP 778 Y ++ ASPWWP++ LS V+ + G + P Sbjct: 36 YSAKPASPWWPNVILSKVLSVSRGVTYSAKP 66 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 870 YKSQSASPWWPHMALSNVVPXTIGXHLALSPKVHFSISEKDNKC 739 Y ++ ASPWWP++ LS V+ ++ + S K D KC Sbjct: 62 YSAKPASPWWPNVILSKVL--SVSGCVTYSAKPAVEWGRGDVKC 103 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,678,223 Number of Sequences: 59808 Number of extensions: 534919 Number of successful extensions: 1260 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1260 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2693287426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -