BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0509.Seq (928 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83217-4|CAB05683.2| 1178|Caenorhabditis elegans Hypothetical pr... 29 3.6 AF025466-2|AAB71033.1| 261|Caenorhabditis elegans Hypothetical ... 29 3.6 >Z83217-4|CAB05683.2| 1178|Caenorhabditis elegans Hypothetical protein C10C6.6 protein. Length = 1178 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 443 GILRYYFLFNLQILKGFIGASKILRYCNIFLPVRCIFICN 324 G YY L L F+ + +L +C+ +PVRC +C+ Sbjct: 43 GYEEYYELGMLGYAAIFVILALVLLFCHWMMPVRCFLMCS 82 >AF025466-2|AAB71033.1| 261|Caenorhabditis elegans Hypothetical protein T23F4.1 protein. Length = 261 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 812 GTTFDKAIXGHHGDAD 859 GTT D +I HHGDAD Sbjct: 175 GTTIDASIQAHHGDAD 190 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,900,829 Number of Sequences: 27780 Number of extensions: 402834 Number of successful extensions: 833 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2381234086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -