BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0509.Seq (928 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54170.1 68418.m06745 expressed protein weak similarity to SP... 30 2.5 At5g47530.1 68418.m05868 auxin-responsive protein, putative simi... 28 7.6 >At5g54170.1 68418.m06745 expressed protein weak similarity to SP|Q9UKL6 Phosphatidylcholine transfer protein (PC-TP) {Homo sapiens} Length = 449 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 700 IFTSISNSAFCPCAFIVFFANAEVNLGRKSQM 795 + S+S AF P AF++ F VN GRK Q+ Sbjct: 405 VVCSLSGGAFVPPAFLLGFGKRFVNGGRKRQL 436 >At5g47530.1 68418.m05868 auxin-responsive protein, putative similar to auxin-induced protein AIR12 (GI:11357190) [Arabidopsis thaliana]; similar to stromal cell derived factor receptor 2 (GI:20381292) [Mus musculus] Length = 395 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 382 VKYYGTAISSYQ-SVAFSFATLAISSFHSLYRNNRTSQHLYLNLP 251 V+ Y + ISSYQ S+ + + +S + Y+NN + LNLP Sbjct: 104 VRAYTSPISSYQTSLLEAELSFNVSQLSATYQNNEMVIYAILNLP 148 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,563,379 Number of Sequences: 28952 Number of extensions: 366934 Number of successful extensions: 726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2207676696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -