BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0505.Seq (960 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 62 3e-11 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.9 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 61.7 bits (143), Expect = 3e-11 Identities = 29/84 (34%), Positives = 45/84 (53%) Frame = +1 Query: 256 KDYKKDNLKVKVKGDFIFVQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDG 435 + + + + VK + + V+G E K+DDH + F Y LP + AD+ + L+SDG Sbjct: 22 QQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPKGHNEADIVSSLSSDG 81 Query: 436 YLVVTAPISENVDKTKNTERVVPI 507 L +T P E + KN ER +PI Sbjct: 82 ILTITCPRKE--IEQKNEERSIPI 103 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.2 bits (50), Expect = 5.9 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 259 DYKKDNLKVKVKGDFIFVQGSQEAKED 339 ++ K+ K K +GDF ++ Q+ +ED Sbjct: 382 EFSKERTKAKNRGDFQKLREKQQIEED 408 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 803,969 Number of Sequences: 2352 Number of extensions: 12813 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 105430005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -