SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0503.Seq
         (884 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z67995-5|CAA91945.2|  176|Caenorhabditis elegans Hypothetical pr...    29   3.3  
Z81133-5|CAB03442.2| 1838|Caenorhabditis elegans Hypothetical pr...    28   7.7  

>Z67995-5|CAA91945.2|  176|Caenorhabditis elegans Hypothetical
           protein M153.3 protein.
          Length = 176

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +1

Query: 343 CCHNLHFNMSMFS 381
           CCH+ HFNM MF+
Sbjct: 68  CCHSCHFNMDMFT 80


>Z81133-5|CAB03442.2| 1838|Caenorhabditis elegans Hypothetical
           protein T28B8.3a protein.
          Length = 1838

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = +3

Query: 324 SWSVWYLLPQSAFQYEHVF*TIKLHIFQICDIILNYIYIN 443
           SW  ++L  +      H F +++ H F I +I +N I +N
Sbjct: 463 SWPTFHLGSEVPMVKTHKFASLRAHAFYILEIFVNQINVN 502


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,230,866
Number of Sequences: 27780
Number of extensions: 312252
Number of successful extensions: 508
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 503
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 508
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2234373834
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -