BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0503.Seq (884 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67995-5|CAA91945.2| 176|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z81133-5|CAB03442.2| 1838|Caenorhabditis elegans Hypothetical pr... 28 7.7 >Z67995-5|CAA91945.2| 176|Caenorhabditis elegans Hypothetical protein M153.3 protein. Length = 176 Score = 29.5 bits (63), Expect = 3.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +1 Query: 343 CCHNLHFNMSMFS 381 CCH+ HFNM MF+ Sbjct: 68 CCHSCHFNMDMFT 80 >Z81133-5|CAB03442.2| 1838|Caenorhabditis elegans Hypothetical protein T28B8.3a protein. Length = 1838 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 324 SWSVWYLLPQSAFQYEHVF*TIKLHIFQICDIILNYIYIN 443 SW ++L + H F +++ H F I +I +N I +N Sbjct: 463 SWPTFHLGSEVPMVKTHKFASLRAHAFYILEIFVNQINVN 502 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,230,866 Number of Sequences: 27780 Number of extensions: 312252 Number of successful extensions: 508 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2234373834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -