Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0501.Seq
         (651 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g31490.1 68414.m03855 transferase family protein contains sim...    29   2.0  

>At1g31490.1 68414.m03855 transferase family protein contains
           similarity to anthranilate N-hydroxycinnamoyl
           benzoyltransferase GI:3288180, GI:2239091 from (Dianthus
           caryophyllus); contains Pfam profile PF02458 transferase
           family
          Length = 444

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -3

Query: 517 KKNHKHDLTI*KINTHFKNVTSDFTFHNILD*IRSHRTNIFTTRL 383
           KKNH  D+    ++     VT+D  F +++D I SHR  +   R+
Sbjct: 311 KKNHVSDIAN-IVHKSITEVTNDTHFTDLIDWIESHRPGLMLARV 354


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,081,015
Number of Sequences: 28952
Number of extensions: 201532
Number of successful extensions: 275
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 274
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 275
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)