BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0498.Seq (504 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal prot... 58 3e-09 Z71264-5|CAA95829.1| 241|Caenorhabditis elegans Hypothetical pr... 29 1.9 >U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal protein, small subunitprotein 2 protein. Length = 272 Score = 58.4 bits (135), Expect = 3e-09 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = -1 Query: 270 APIPKNFFRWLGVQDLLTGQLRGSTGTLGNFAKPHTXPIAKTYAYXTPDLWR 115 AP+PK G++D T +GST TLGNFAK + +TY+Y TPDLW+ Sbjct: 203 APVPKKLLHMAGIEDCYTAA-KGSTATLGNFAKATYAALQRTYSYLTPDLWK 253 >Z71264-5|CAA95829.1| 241|Caenorhabditis elegans Hypothetical protein K07G5.2 protein. Length = 241 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 222 LTGQLRGSTGTLGNFAKPHTXPIAKTYAYXTPDLWR 115 L Q+RG++G +F +PHT K + D WR Sbjct: 192 LRQQIRGTSGVKVDFGRPHTHEFGKE-THVEEDTWR 226 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,120,680 Number of Sequences: 27780 Number of extensions: 154873 Number of successful extensions: 228 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 227 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -